LOCUS       CR533456                 823 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834F1016D for
            gene DKFZP564O123, DKFZP564O123 protein; complete cds, incl.
            stopcodon.
ACCESSION   CR533456
VERSION     CR533456.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 642)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 642)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (21-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834F1016D, ORFNo 2763
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834F1016D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full ORF clones
            generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            After the stop codon 3' UTR sequence is present in front of the
            3' att site (ACCCAGCTTTCTT).
            Compared to the reference sequence AL080122
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..823
                     /db_xref="H-InvDB:HIT000268304"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834F1016D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..642
                     /codon_start=1
                     /gene="DKFZP564O123"
                     /db_xref="GOA:Q9UQN3"
                     /db_xref="H-InvDB:HIT000268304.12"
                     /db_xref="HGNC:HGNC:24537"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="PDB:2JQK"
                     /db_xref="UniProtKB/Swiss-Prot:Q9UQN3"
                     /protein_id="CAG38487.1"
                     /translation="MASLFKKRTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLEL
                     EIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAM
                     STTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQ
                     DIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDVEIERQLKALGVD"
BASE COUNT          319 a          137 c          170 g          197 t
ORIGIN      
        1 atggcgtccc tcttcaagaa gagaaccgtg gatgatgtaa taaaggaaca gaatcgagag
       61 ttacgaggta cacagagggc tataatcaga gatcgagcag ctttagagaa acaagaaaaa
      121 cagctggaat tagaaattaa gaaaatggcc aagattggta ataaggaagc ttgcaaagtt
      181 ttagccaaac aacttgtgca tctacggaaa cagaagacga gaacttttgc tgtaagttca
      241 aaagttactt ctatgtctac acaaacaaaa gtgatgaatt cccaaatgaa gatggctgga
      301 gcaatgtcta ccacagcaaa aacaatgcag gcagttaaca agaagatgga tccacaaaag
      361 acattacaaa caatgcagaa tttccagaag gaaaacatga aaatggaaat gactgaagaa
      421 atgatcaatg atacacttga tgacatcttt gacggttctg atgacgaaga agaaagccag
      481 gatattgtga atcaagttct tgatgaaatt ggaattgaaa tttctggaaa gatggccaaa
      541 gctccatcag ctgctcgaag cttaccatct gcctctactt caaaggctac aatctcagat
      601 gtagagattg aacggcaact caaggcttta ggagtagatt agtcaaaaga agtcatacta
      661 ttttgcttac ttaaaattat gtagtataaa ccaagcacag tgcagatttc ttttacaaaa
      721 cacatgtatt ttgcaaaaaa aaaaaaatgg agaccatgag tgaacagttg tttcctaacc
      781 catggctatt tagaatcttt tgccaaagaa tgacaatgat gca
//