LOCUS CR533450 478 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834G1216D for gene DSIPI, delta sleep inducing peptide, immunoreactor; complete cds, incl. stopcodon. ACCESSION CR533450 VERSION CR533450.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 393) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 393) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (21-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834G1216D, ORFNo 2755 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834G1216D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full ORF clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). After the stop codon 3' UTR sequence is present in front of the 3' att site (ACCCAGCTTTCTT). Compared to the reference sequence AL110191 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..478 /db_xref="H-InvDB:HIT000268298" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834G1216D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..393 /codon_start=1 /gene="DSIPI" /db_xref="GOA:Q99576" /db_xref="H-InvDB:HIT000268298.13" /db_xref="HGNC:HGNC:3051" /db_xref="InterPro:IPR000580" /db_xref="UniProtKB/Swiss-Prot:Q99576" /protein_id="CAG38481.1" /translation="MYQTPMEVAVYQLHNFSISFFSSLLGGDVVSVKLDNSASGASVV AIDNKIEQAMDLVKNHLMYAVREEVEILKEQIRELVEKNSQLERENTLLKTLASPEQL EKFQSCLSPEEPAPESPQVPEAPGGSAV" BASE COUNT 106 a 124 c 136 g 112 t ORIGIN 1 atgtatcaga cccccatgga ggtggcggtc taccagctgc acaatttctc catctccttc 61 ttctcttctc tgcttggagg ggatgtggtt tccgttaagc tggacaacag tgcctccgga 121 gccagcgtgg tggccataga caacaagatc gaacaggcca tggatctggt gaagaatcat 181 ctgatgtatg ctgtgagaga ggaggtggag atcctgaagg agcagatccg agagctggtg 241 gagaagaact cccagctaga gcgtgagaac accctgttga agaccctggc aagcccagag 301 cagctggaga agttccagtc ctgtctgagc cctgaagagc cagctcccga atccccacaa 361 gtgcccgagg cccctggtgg ttctgcggtg taagtggctc tgtcctcagg gtgggcagag 421 ccactaaact tgttttacct agttctttcc agtttgtttt tggctcccca agcatcat //