LOCUS       CR533450                 478 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834G1216D for
            gene DSIPI, delta sleep inducing peptide, immunoreactor; complete
            cds, incl. stopcodon.
ACCESSION   CR533450
VERSION     CR533450.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 393)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 393)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (21-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834G1216D, ORFNo 2755
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834G1216D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full ORF clones
            generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            After the stop codon 3' UTR sequence is present in front of the
            3' att site (ACCCAGCTTTCTT).
            Compared to the reference sequence AL110191
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..478
                     /db_xref="H-InvDB:HIT000268298"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834G1216D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..393
                     /codon_start=1
                     /gene="DSIPI"
                     /db_xref="GOA:Q99576"
                     /db_xref="H-InvDB:HIT000268298.13"
                     /db_xref="HGNC:HGNC:3051"
                     /db_xref="InterPro:IPR000580"
                     /db_xref="UniProtKB/Swiss-Prot:Q99576"
                     /protein_id="CAG38481.1"
                     /translation="MYQTPMEVAVYQLHNFSISFFSSLLGGDVVSVKLDNSASGASVV
                     AIDNKIEQAMDLVKNHLMYAVREEVEILKEQIRELVEKNSQLERENTLLKTLASPEQL
                     EKFQSCLSPEEPAPESPQVPEAPGGSAV"
BASE COUNT          106 a          124 c          136 g          112 t
ORIGIN      
        1 atgtatcaga cccccatgga ggtggcggtc taccagctgc acaatttctc catctccttc
       61 ttctcttctc tgcttggagg ggatgtggtt tccgttaagc tggacaacag tgcctccgga
      121 gccagcgtgg tggccataga caacaagatc gaacaggcca tggatctggt gaagaatcat
      181 ctgatgtatg ctgtgagaga ggaggtggag atcctgaagg agcagatccg agagctggtg
      241 gagaagaact cccagctaga gcgtgagaac accctgttga agaccctggc aagcccagag
      301 cagctggaga agttccagtc ctgtctgagc cctgaagagc cagctcccga atccccacaa
      361 gtgcccgagg cccctggtgg ttctgcggtg taagtggctc tgtcctcagg gtgggcagag
      421 ccactaaact tgttttacct agttctttcc agtttgtttt tggctcccca agcatcat
//