LOCUS       CR533447                 808 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834H1116D for
            gene DKFZP434B195, hypothetical protein DKFZp434B195; complete cds,
            incl. stopcodon.
ACCESSION   CR533447
VERSION     CR533447.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 669)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 669)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (21-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834H1116D, ORFNo 2751
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H1116D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full ORF clones
            generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            After the stop codon 3' UTR sequence is present in front of the
            3' att site (ACCCAGCTTTCTT).
            Compared to the reference sequence AL136873
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..808
                     /db_xref="H-InvDB:HIT000268295"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834H1116D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..669
                     /codon_start=1
                     /gene="DKFZP434B195"
                     /db_xref="GOA:Q9BRR6"
                     /db_xref="H-InvDB:HIT000268295.12"
                     /db_xref="HGNC:HGNC:25250"
                     /db_xref="InterPro:IPR007666"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/Swiss-Prot:Q9BRR6"
                     /protein_id="CAG38478.1"
                     /translation="MAASCRVVTSISDIPTGIPVHLELASMTNRELMSSIVHQVFPAV
                     TSLGLNEQELLFLTQSASGPHSSLSSWNGVPDVGMVSDILFWILKEHGRSKSRASDLT
                     RIHFHTLVYHILATVDGHWANQLAAVAAGARVAGTQACATETIDTSRVSLRAPQEFMT
                     SHSEAGSRIVLNPNKPVVEWHREGISFHFTPVLVCKDPIRTVGLGDAISAEGLFYSEV
                     HPHY"
BASE COUNT          211 a          205 c          201 g          191 t
ORIGIN      
        1 atggctgcaa gctgcagggt tgtaacctcc atttctgaca tccccactgg tattccagtt
       61 cacctagagc tggccagtat gactaacagg gagctcatga gcagcattgt ccatcaggtc
      121 tttcccgcgg tgacttccct tgggctgaat gaacaggagc tgttatttct cacccagtca
      181 gcctctggac ctcactcttc tctctcttcc tggaacggtg ttcctgatgt gggcatggtc
      241 agtgacatcc tcttctggat cttgaaagaa catgggagga gtaaaagcag agcctcggat
      301 ctcaccagga tccatttcca cacgctggtc taccacatcc tggcaactgt ggatggacac
      361 tgggccaacc agctggcagc cgtggctgca ggagctcgtg tggctgggac acaggcctgc
      421 gccacagaaa ccatagacac cagccgagtg tctctgaggg caccccaaga gttcatgact
      481 tcccattcgg aggcaggctc caggattgta ttaaacccaa acaagccagt agtagaatgg
      541 cacagagagg gaatatcctt ccacttcaca ccagtattgg tgtgtaaaga ccccattcga
      601 actgtaggcc ttggagatgc catttcagcc gaaggactct tctattcgga agtacaccct
      661 cactattagg aagattctta ggggtaattt ttctgaggaa ggagaactag ccaacttaag
      721 aattacagga agaaagtggt ttggaagaca gccaaagaaa taaaagcaga ttaaattgta
      781 tcaggtacat tccagcctgt tggcaact
//