LOCUS CR533447 808 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834H1116D for gene DKFZP434B195, hypothetical protein DKFZp434B195; complete cds, incl. stopcodon. ACCESSION CR533447 VERSION CR533447.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 669) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 669) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (21-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834H1116D, ORFNo 2751 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H1116D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full ORF clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). After the stop codon 3' UTR sequence is present in front of the 3' att site (ACCCAGCTTTCTT). Compared to the reference sequence AL136873 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..808 /db_xref="H-InvDB:HIT000268295" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834H1116D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..669 /codon_start=1 /gene="DKFZP434B195" /db_xref="GOA:Q9BRR6" /db_xref="H-InvDB:HIT000268295.12" /db_xref="HGNC:HGNC:25250" /db_xref="InterPro:IPR007666" /db_xref="InterPro:IPR029056" /db_xref="UniProtKB/Swiss-Prot:Q9BRR6" /protein_id="CAG38478.1" /translation="MAASCRVVTSISDIPTGIPVHLELASMTNRELMSSIVHQVFPAV TSLGLNEQELLFLTQSASGPHSSLSSWNGVPDVGMVSDILFWILKEHGRSKSRASDLT RIHFHTLVYHILATVDGHWANQLAAVAAGARVAGTQACATETIDTSRVSLRAPQEFMT SHSEAGSRIVLNPNKPVVEWHREGISFHFTPVLVCKDPIRTVGLGDAISAEGLFYSEV HPHY" BASE COUNT 211 a 205 c 201 g 191 t ORIGIN 1 atggctgcaa gctgcagggt tgtaacctcc atttctgaca tccccactgg tattccagtt 61 cacctagagc tggccagtat gactaacagg gagctcatga gcagcattgt ccatcaggtc 121 tttcccgcgg tgacttccct tgggctgaat gaacaggagc tgttatttct cacccagtca 181 gcctctggac ctcactcttc tctctcttcc tggaacggtg ttcctgatgt gggcatggtc 241 agtgacatcc tcttctggat cttgaaagaa catgggagga gtaaaagcag agcctcggat 301 ctcaccagga tccatttcca cacgctggtc taccacatcc tggcaactgt ggatggacac 361 tgggccaacc agctggcagc cgtggctgca ggagctcgtg tggctgggac acaggcctgc 421 gccacagaaa ccatagacac cagccgagtg tctctgaggg caccccaaga gttcatgact 481 tcccattcgg aggcaggctc caggattgta ttaaacccaa acaagccagt agtagaatgg 541 cacagagagg gaatatcctt ccacttcaca ccagtattgg tgtgtaaaga ccccattcga 601 actgtaggcc ttggagatgc catttcagcc gaaggactct tctattcgga agtacaccct 661 cactattagg aagattctta ggggtaattt ttctgaggaa ggagaactag ccaacttaag 721 aattacagga agaaagtggt ttggaagaca gccaaagaaa taaaagcaga ttaaattgta 781 tcaggtacat tccagcctgt tggcaact //