LOCUS       CR457437                 840 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834D076D for
            gene FHL2, four and a half LIM domains 2; complete cds, incl.
            stopcodon.
ACCESSION   CR457437
VERSION     CR457437.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 840)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 840)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834D076D, ORFNo 2727
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834D076D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence BT006960 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..840
                     /db_xref="H-InvDB:HIT000268287"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834D076D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..840
                     /codon_start=1
                     /gene="FHL2"
                     /db_xref="GOA:Q6I9R8"
                     /db_xref="H-InvDB:HIT000268287.13"
                     /db_xref="InterPro:IPR001781"
                     /db_xref="InterPro:IPR037987"
                     /db_xref="UniProtKB/TrEMBL:Q6I9R8"
                     /protein_id="CAG33718.1"
                     /translation="MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECG
                     KPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQ
                     ECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAM
                     QCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYA
                     KKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCG
                     KDI"
BASE COUNT          203 a          232 c          227 g          178 t
ORIGIN      
        1 atgactgagc gctttgactg ccaccattgc aacgaatctc tctttggcaa gaagtacatc
       61 ctgcgggagg agagccccta ctgcgtggtg tgctttgaga ccctgttcgc caacacctgc
      121 gaggagtgtg ggaagcccat cggctgtgac tgcaaggact tgtcttacaa ggaccggcac
      181 tggcatgaag cctgtttcca ctgctcgcag tgcagaaact cactggtgga caagcccttt
      241 gctgccaagg aggaccagct gctctgtaca gactgctatt ccaacgagta ctcatccaag
      301 tgccaggaat gcaagaagac catcatgcca ggtacccgca agatggagta caagggcagc
      361 agctggcatg agacctgctt catctgccac cgctgccagc agccaattgg aaccaagagt
      421 ttcatcccca aagacaatca gaatttctgt gtgccctgct atgagaaaca acatgccatg
      481 cagtgcgttc agtgcaaaaa gcccatcacc acgggagggg tcacttaccg ggagcagccc
      541 tggcacaagg agtgcttcgt gtgcaccgcc tgcaggaagc agctgtctgg gcagcgcttc
      601 acagctcgcg atgactttgc ctactgcctg aactgcttct gtgacttgta tgccaagaag
      661 tgtgctgggt gcaccaaccc catcagcgga cttggtggca caaaatacat ctcctttgag
      721 gaacggcagt ggcataacga ctgctttaac tgtaagaagt gctccctctc actggtgggg
      781 cgtggcttcc tcacagagag ggatgacatc ctgtgccccg actgtgggaa agacatttaa
//