LOCUS CR457437 840 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834D076D for gene FHL2, four and a half LIM domains 2; complete cds, incl. stopcodon. ACCESSION CR457437 VERSION CR457437.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 840) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 840) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834D076D, ORFNo 2727 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834D076D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence BT006960 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..840 /db_xref="H-InvDB:HIT000268287" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834D076D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..840 /codon_start=1 /gene="FHL2" /db_xref="GOA:Q6I9R8" /db_xref="H-InvDB:HIT000268287.13" /db_xref="InterPro:IPR001781" /db_xref="InterPro:IPR037987" /db_xref="UniProtKB/TrEMBL:Q6I9R8" /protein_id="CAG33718.1" /translation="MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECG KPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQ ECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAM QCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYA KKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCG KDI" BASE COUNT 203 a 232 c 227 g 178 t ORIGIN 1 atgactgagc gctttgactg ccaccattgc aacgaatctc tctttggcaa gaagtacatc 61 ctgcgggagg agagccccta ctgcgtggtg tgctttgaga ccctgttcgc caacacctgc 121 gaggagtgtg ggaagcccat cggctgtgac tgcaaggact tgtcttacaa ggaccggcac 181 tggcatgaag cctgtttcca ctgctcgcag tgcagaaact cactggtgga caagcccttt 241 gctgccaagg aggaccagct gctctgtaca gactgctatt ccaacgagta ctcatccaag 301 tgccaggaat gcaagaagac catcatgcca ggtacccgca agatggagta caagggcagc 361 agctggcatg agacctgctt catctgccac cgctgccagc agccaattgg aaccaagagt 421 ttcatcccca aagacaatca gaatttctgt gtgccctgct atgagaaaca acatgccatg 481 cagtgcgttc agtgcaaaaa gcccatcacc acgggagggg tcacttaccg ggagcagccc 541 tggcacaagg agtgcttcgt gtgcaccgcc tgcaggaagc agctgtctgg gcagcgcttc 601 acagctcgcg atgactttgc ctactgcctg aactgcttct gtgacttgta tgccaagaag 661 tgtgctgggt gcaccaaccc catcagcgga cttggtggca caaaatacat ctcctttgag 721 gaacggcagt ggcataacga ctgctttaac tgtaagaagt gctccctctc actggtgggg 781 cgtggcttcc tcacagagag ggatgacatc ctgtgccccg actgtgggaa agacatttaa //