LOCUS       CR457403                 897 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834C0818D for
            gene ATP5C1, ATP synthase, H+ transporting, mitochondrial F1
            complex, gamma polypeptide 1; complete cds, incl. stopcodon.
ACCESSION   CR457403
VERSION     CR457403.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 897)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 897)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834C0818D, ORFNo 2584
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834C0818D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence BC000470 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..897
                     /db_xref="H-InvDB:HIT000268253"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834C0818D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..897
                     /codon_start=1
                     /gene="ATP5C1"
                     /db_xref="GOA:P36542"
                     /db_xref="H-InvDB:HIT000268253.14"
                     /db_xref="HGNC:HGNC:833"
                     /db_xref="InterPro:IPR000131"
                     /db_xref="InterPro:IPR023632"
                     /db_xref="InterPro:IPR035968"
                     /db_xref="UniProtKB/Swiss-Prot:P36542"
                     /protein_id="CAG33684.1"
                     /translation="MFSRAGVAGLSAWTLQPQWIQVRNMATLKDITRRLKSIKNIQKI
                     TKSMKMVAAAKYARAERELKPARIYGLGSLALYEKADIKGPEDKKKHLLIGVSSDRGL
                     CGAIHSSIAKQMKSEVATLTAAGKEVMLVGIGDKIRGILYRTHSDQFLVAFKEVGRKP
                     PTFGDASVIALELLNSGYEFDEGSIIFNKFRSVISYKTEEKPIFSLNTVASADSMSIY
                     DDIDADVLQNYQEYNLANIIYYSLKESTTSEQSARMTAMDNASKNASEMIDKLTLTFN
                     RTRQAVITKELIEIISGAAALD"
BASE COUNT          275 a          189 c          204 g          229 t
ORIGIN      
        1 atgttctctc gcgcgggtgt cgctgggctg tcggcctgga ccttgcagcc gcaatggatt
       61 caagttcgaa atatggcaac tttgaaagat atcaccagga gactaaagtc catcaaaaac
      121 atccagaaaa ttaccaagtc tatgaaaatg gtagcggcag caaaatatgc ccgagctgag
      181 agagagctga aaccagctcg aatatatgga ttgggatctt tagctctgta tgaaaaagct
      241 gatatcaagg ggcctgaaga caagaagaaa cacctcctta ttggtgtgtc ctcagatcga
      301 ggactgtgtg gtgctattca ttcctccatt gctaaacaga tgaaaagcga ggttgctaca
      361 ctaacagcag ctgggaaaga agttatgctt gttggaattg gtgacaaaat cagaggcata
      421 ctttatagga ctcattctga ccagtttctg gtggcattca aagaagtggg aagaaagccc
      481 cccacttttg gagatgcgtc agtcattgcc cttgaattac taaattctgg atatgaattt
      541 gatgaaggct ccatcatctt taataaattc aggtctgtca tctcctataa gacagaagaa
      601 aagcccatct tttcccttaa taccgttgca agtgctgaca gcatgagtat ctatgacgat
      661 attgatgctg acgtgctgca aaattaccaa gaatacaatc tggccaacat catctactac
      721 tctctgaagg agtccaccac tagtgagcag agtgccagga tgacagccat ggacaatgcc
      781 agcaagaatg cttctgagat gattgacaaa ttgacattga cattcaaccg tacccgccaa
      841 gctgtcatca caaaagagtt gattgaaatt atctctggtg ctgcagctct ggattaa
//