LOCUS CR457403 897 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834C0818D for gene ATP5C1, ATP synthase, H+ transporting, mitochondrial F1 complex, gamma polypeptide 1; complete cds, incl. stopcodon. ACCESSION CR457403 VERSION CR457403.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 897) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 897) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834C0818D, ORFNo 2584 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834C0818D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence BC000470 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..897 /db_xref="H-InvDB:HIT000268253" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834C0818D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..897 /codon_start=1 /gene="ATP5C1" /db_xref="GOA:P36542" /db_xref="H-InvDB:HIT000268253.14" /db_xref="HGNC:HGNC:833" /db_xref="InterPro:IPR000131" /db_xref="InterPro:IPR023632" /db_xref="InterPro:IPR035968" /db_xref="UniProtKB/Swiss-Prot:P36542" /protein_id="CAG33684.1" /translation="MFSRAGVAGLSAWTLQPQWIQVRNMATLKDITRRLKSIKNIQKI TKSMKMVAAAKYARAERELKPARIYGLGSLALYEKADIKGPEDKKKHLLIGVSSDRGL CGAIHSSIAKQMKSEVATLTAAGKEVMLVGIGDKIRGILYRTHSDQFLVAFKEVGRKP PTFGDASVIALELLNSGYEFDEGSIIFNKFRSVISYKTEEKPIFSLNTVASADSMSIY DDIDADVLQNYQEYNLANIIYYSLKESTTSEQSARMTAMDNASKNASEMIDKLTLTFN RTRQAVITKELIEIISGAAALD" BASE COUNT 275 a 189 c 204 g 229 t ORIGIN 1 atgttctctc gcgcgggtgt cgctgggctg tcggcctgga ccttgcagcc gcaatggatt 61 caagttcgaa atatggcaac tttgaaagat atcaccagga gactaaagtc catcaaaaac 121 atccagaaaa ttaccaagtc tatgaaaatg gtagcggcag caaaatatgc ccgagctgag 181 agagagctga aaccagctcg aatatatgga ttgggatctt tagctctgta tgaaaaagct 241 gatatcaagg ggcctgaaga caagaagaaa cacctcctta ttggtgtgtc ctcagatcga 301 ggactgtgtg gtgctattca ttcctccatt gctaaacaga tgaaaagcga ggttgctaca 361 ctaacagcag ctgggaaaga agttatgctt gttggaattg gtgacaaaat cagaggcata 421 ctttatagga ctcattctga ccagtttctg gtggcattca aagaagtggg aagaaagccc 481 cccacttttg gagatgcgtc agtcattgcc cttgaattac taaattctgg atatgaattt 541 gatgaaggct ccatcatctt taataaattc aggtctgtca tctcctataa gacagaagaa 601 aagcccatct tttcccttaa taccgttgca agtgctgaca gcatgagtat ctatgacgat 661 attgatgctg acgtgctgca aaattaccaa gaatacaatc tggccaacat catctactac 721 tctctgaagg agtccaccac tagtgagcag agtgccagga tgacagccat ggacaatgcc 781 agcaagaatg cttctgagat gattgacaaa ttgacattga cattcaaccg tacccgccaa 841 gctgtcatca caaaagagtt gattgaaatt atctctggtg ctgcagctct ggattaa //