LOCUS CR457398 930 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834B0514D for gene DKFZP566F0546, DKFZP566F0546 protein; complete cds, incl. stopcodon. ACCESSION CR457398 VERSION CR457398.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 930) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 930) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834B0514D, ORFNo 2576 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834B0514D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_015653 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..930 /db_xref="H-InvDB:HIT000268248" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834B0514D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..930 /codon_start=1 /gene="DKFZP566F0546" /db_xref="GOA:Q9H4K1" /db_xref="H-InvDB:HIT000268248.12" /db_xref="HGNC:HGNC:13241" /db_xref="InterPro:IPR008805" /db_xref="UniProtKB/Swiss-Prot:Q9H4K1" /protein_id="CAG33679.1" /translation="MRQNDKIMCILENRKKRDRKNLCRAINDFQQSFQKPETRREFDL SDPLALKKDLPARQSDNDVRNTISGMQKFMGEDLNFHERKKFQEEQNREWSLQQQREW KNARAEQKCAEALYTETRLQFDETAKHLQKLESTTRKAVCASVKDFNKSQAIESVERK KQEKKQEQEDNLAEITNLLRGDLLSENPQQAASSFGPHRVVPDRWKGMTQEQLEQIRL VQKQQIQEKLRLQEEKRQRDLDWDRRRIQGARATLLFERQQWRRQRDLRRALDSSNLS LAKEQHLQKKYMNEVYTNQPTGDYFTQFNTGSR" BASE COUNT 301 a 228 c 254 g 147 t ORIGIN 1 atgaggcaaa atgacaaaat catgtgcata ttggaaaacc ggaaaaagag ggataggaaa 61 aatctctgta gggctatcaa tgacttccaa cagagctttc agaagccaga aactcgccgt 121 gaatttgatc tgtccgaccc cctagccctt aagaaagatc ttccagcccg gcagtcagat 181 aatgatgttc ggaatacgat atcaggaatg cagaaattca tgggagagga tttaaacttc 241 catgagagga agaaattcca agaggaacaa aacagagaat ggtctttgca gcagcaaagg 301 gaatggaaga acgcccgtgc tgaacaaaaa tgcgcagagg ccctctacac agagacaagg 361 ctgcagtttg acgagacagc caagcacctc cagaagctgg aaagcaccac cagaaaggca 421 gtttgtgcat ctgtgaaaga cttcaacaag agccaggcca tcgagtcagt ggaaaggaaa 481 aagcaagaga aaaagcaaga acaagaggac aacttggccg agatcaccaa cctcctgcgt 541 ggggacctgc tctccgagaa cccgcagcag gcagccagct ccttcgggcc ccaccgcgtg 601 gtccctgacc gctggaaggg catgacccag gagcagctgg agcagatccg cctagtccag 661 aagcagcaaa tccaggagaa gctgaggctc caggaagaaa agcgccagcg agacctggac 721 tgggaccggc ggaggattca gggggctcgc gccaccctgc tgtttgagcg gcagcagtgg 781 cggcggcagc gcgacctgcg cagagctctg gacagcagca acctcagcct ggccaaggag 841 cagcatttgc agaaaaaata tatgaatgaa gtctatacaa atcaacccac gggagactat 901 ttcacacaat ttaatacagg aagtcgttaa //