LOCUS       CR457398                 930 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834B0514D for
            gene DKFZP566F0546, DKFZP566F0546 protein; complete cds, incl.
            stopcodon.
ACCESSION   CR457398
VERSION     CR457398.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 930)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 930)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834B0514D, ORFNo 2576
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834B0514D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence NM_015653 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..930
                     /db_xref="H-InvDB:HIT000268248"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834B0514D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..930
                     /codon_start=1
                     /gene="DKFZP566F0546"
                     /db_xref="GOA:Q9H4K1"
                     /db_xref="H-InvDB:HIT000268248.12"
                     /db_xref="HGNC:HGNC:13241"
                     /db_xref="InterPro:IPR008805"
                     /db_xref="UniProtKB/Swiss-Prot:Q9H4K1"
                     /protein_id="CAG33679.1"
                     /translation="MRQNDKIMCILENRKKRDRKNLCRAINDFQQSFQKPETRREFDL
                     SDPLALKKDLPARQSDNDVRNTISGMQKFMGEDLNFHERKKFQEEQNREWSLQQQREW
                     KNARAEQKCAEALYTETRLQFDETAKHLQKLESTTRKAVCASVKDFNKSQAIESVERK
                     KQEKKQEQEDNLAEITNLLRGDLLSENPQQAASSFGPHRVVPDRWKGMTQEQLEQIRL
                     VQKQQIQEKLRLQEEKRQRDLDWDRRRIQGARATLLFERQQWRRQRDLRRALDSSNLS
                     LAKEQHLQKKYMNEVYTNQPTGDYFTQFNTGSR"
BASE COUNT          301 a          228 c          254 g          147 t
ORIGIN      
        1 atgaggcaaa atgacaaaat catgtgcata ttggaaaacc ggaaaaagag ggataggaaa
       61 aatctctgta gggctatcaa tgacttccaa cagagctttc agaagccaga aactcgccgt
      121 gaatttgatc tgtccgaccc cctagccctt aagaaagatc ttccagcccg gcagtcagat
      181 aatgatgttc ggaatacgat atcaggaatg cagaaattca tgggagagga tttaaacttc
      241 catgagagga agaaattcca agaggaacaa aacagagaat ggtctttgca gcagcaaagg
      301 gaatggaaga acgcccgtgc tgaacaaaaa tgcgcagagg ccctctacac agagacaagg
      361 ctgcagtttg acgagacagc caagcacctc cagaagctgg aaagcaccac cagaaaggca
      421 gtttgtgcat ctgtgaaaga cttcaacaag agccaggcca tcgagtcagt ggaaaggaaa
      481 aagcaagaga aaaagcaaga acaagaggac aacttggccg agatcaccaa cctcctgcgt
      541 ggggacctgc tctccgagaa cccgcagcag gcagccagct ccttcgggcc ccaccgcgtg
      601 gtccctgacc gctggaaggg catgacccag gagcagctgg agcagatccg cctagtccag
      661 aagcagcaaa tccaggagaa gctgaggctc caggaagaaa agcgccagcg agacctggac
      721 tgggaccggc ggaggattca gggggctcgc gccaccctgc tgtttgagcg gcagcagtgg
      781 cggcggcagc gcgacctgcg cagagctctg gacagcagca acctcagcct ggccaaggag
      841 cagcatttgc agaaaaaata tatgaatgaa gtctatacaa atcaacccac gggagactat
      901 ttcacacaat ttaatacagg aagtcgttaa
//