LOCUS       CR457390                1041 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834B0414D for
            gene TMEFF2, transmembrane protein with EGF-like and two
            follistatin-like domains 2; complete cds, incl. stopcodon.
ACCESSION   CR457390
VERSION     CR457390.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1041)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 1041)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834B0414D, ORFNo 2563
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834B0414D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence AL157430 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..1041
                     /db_xref="H-InvDB:HIT000268240"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834B0414D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..1041
                     /codon_start=1
                     /gene="TMEFF2"
                     /db_xref="GOA:Q9UIK5"
                     /db_xref="H-InvDB:HIT000268240.12"
                     /db_xref="HGNC:HGNC:11867"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR002350"
                     /db_xref="InterPro:IPR013032"
                     /db_xref="InterPro:IPR036058"
                     /db_xref="PDB:2FMW"
                     /db_xref="UniProtKB/Swiss-Prot:Q9UIK5"
                     /protein_id="CAG33671.1"
                     /translation="MVLWESPRQCSSWTLCEGFCWLLLLPVMLLIVARPVKLAAFPTS
                     LSDCQTPTGWNCSGYDDRENDLFLCDTNTCKFDGECLRIGDTVTCVCQFKCNNDYVPV
                     CGSNGESYQNECYLRQAACKQQSEILVVSEGSCATDAGSGSGDGVHEGSGETSQKETS
                     TCDICQFGAECDEDAEDVWCVCNIDCSQTNFNPLCASDGKSYDNACQIKEASCQKQEK
                     IEVMSLGRCQDNTTTTTKSEDGHYARTDYAENANKLEESAREHHIPCPEHYNGFCMHG
                     KCEHSINMQEPSCRCDAGYTGQHCEKKDYSVLYVVPGPVRFQYVLIAAVIGTIQIAVI
                     CVVVLCITRAKL"
BASE COUNT          283 a          221 c          267 g          270 t
ORIGIN      
        1 atggtgctgt gggagtcccc gcggcagtgc agcagctgga cactttgcga gggcttttgc
       61 tggctgctgc tgctgcccgt catgctactc atcgtagccc gcccggtgaa gctcgctgct
      121 ttccctacct ccttaagtga ctgccaaacg cccaccggct ggaattgctc tggttatgat
      181 gacagagaaa atgatctctt cctctgtgac accaacacct gtaaatttga tggggaatgt
      241 ttaagaattg gagacactgt gacttgcgtc tgtcagttca agtgcaacaa tgactatgtg
      301 cctgtgtgtg gctccaatgg ggagagctac cagaatgagt gttacctgcg acaggctgca
      361 tgcaaacagc agagtgagat acttgtggta tcagaaggat catgtgccac agatgcagga
      421 tcaggatctg gagatggagt ccatgaaggc tctggagaaa ctagtcaaaa ggagacatcc
      481 acctgtgata tttgccagtt tggtgcagaa tgtgacgaag atgccgagga tgtctggtgt
      541 gtgtgtaata ttgactgttc tcaaaccaac ttcaatcccc tctgcgcttc tgatgggaaa
      601 tcttatgata atgcatgcca aatcaaagaa gcatcgtgtc agaaacagga gaaaattgaa
      661 gtcatgtctt tgggtcgatg tcaagataac acaactacaa ctactaagtc tgaagatggg
      721 cattatgcaa gaacagatta tgcagagaat gctaacaaat tagaagaaag tgccagagaa
      781 caccacatac cttgtccgga acattacaat ggcttctgca tgcatgggaa gtgtgagcat
      841 tctatcaata tgcaggagcc atcttgcagg tgtgatgctg gttatactgg acaacactgt
      901 gaaaaaaagg actacagtgt tctatacgtt gttcccggtc ctgtacgatt tcagtatgtc
      961 ttaatcgcag ctgtgattgg aacaattcag attgctgtca tctgtgtggt ggtcctctgc
     1021 atcacaaggg ccaaacttta a
//