LOCUS CR457390 1041 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834B0414D for gene TMEFF2, transmembrane protein with EGF-like and two follistatin-like domains 2; complete cds, incl. stopcodon. ACCESSION CR457390 VERSION CR457390.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1041) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 1041) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834B0414D, ORFNo 2563 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834B0414D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence AL157430 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..1041 /db_xref="H-InvDB:HIT000268240" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834B0414D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..1041 /codon_start=1 /gene="TMEFF2" /db_xref="GOA:Q9UIK5" /db_xref="H-InvDB:HIT000268240.12" /db_xref="HGNC:HGNC:11867" /db_xref="InterPro:IPR000742" /db_xref="InterPro:IPR002350" /db_xref="InterPro:IPR013032" /db_xref="InterPro:IPR036058" /db_xref="PDB:2FMW" /db_xref="UniProtKB/Swiss-Prot:Q9UIK5" /protein_id="CAG33671.1" /translation="MVLWESPRQCSSWTLCEGFCWLLLLPVMLLIVARPVKLAAFPTS LSDCQTPTGWNCSGYDDRENDLFLCDTNTCKFDGECLRIGDTVTCVCQFKCNNDYVPV CGSNGESYQNECYLRQAACKQQSEILVVSEGSCATDAGSGSGDGVHEGSGETSQKETS TCDICQFGAECDEDAEDVWCVCNIDCSQTNFNPLCASDGKSYDNACQIKEASCQKQEK IEVMSLGRCQDNTTTTTKSEDGHYARTDYAENANKLEESAREHHIPCPEHYNGFCMHG KCEHSINMQEPSCRCDAGYTGQHCEKKDYSVLYVVPGPVRFQYVLIAAVIGTIQIAVI CVVVLCITRAKL" BASE COUNT 283 a 221 c 267 g 270 t ORIGIN 1 atggtgctgt gggagtcccc gcggcagtgc agcagctgga cactttgcga gggcttttgc 61 tggctgctgc tgctgcccgt catgctactc atcgtagccc gcccggtgaa gctcgctgct 121 ttccctacct ccttaagtga ctgccaaacg cccaccggct ggaattgctc tggttatgat 181 gacagagaaa atgatctctt cctctgtgac accaacacct gtaaatttga tggggaatgt 241 ttaagaattg gagacactgt gacttgcgtc tgtcagttca agtgcaacaa tgactatgtg 301 cctgtgtgtg gctccaatgg ggagagctac cagaatgagt gttacctgcg acaggctgca 361 tgcaaacagc agagtgagat acttgtggta tcagaaggat catgtgccac agatgcagga 421 tcaggatctg gagatggagt ccatgaaggc tctggagaaa ctagtcaaaa ggagacatcc 481 acctgtgata tttgccagtt tggtgcagaa tgtgacgaag atgccgagga tgtctggtgt 541 gtgtgtaata ttgactgttc tcaaaccaac ttcaatcccc tctgcgcttc tgatgggaaa 601 tcttatgata atgcatgcca aatcaaagaa gcatcgtgtc agaaacagga gaaaattgaa 661 gtcatgtctt tgggtcgatg tcaagataac acaactacaa ctactaagtc tgaagatggg 721 cattatgcaa gaacagatta tgcagagaat gctaacaaat tagaagaaag tgccagagaa 781 caccacatac cttgtccgga acattacaat ggcttctgca tgcatgggaa gtgtgagcat 841 tctatcaata tgcaggagcc atcttgcagg tgtgatgctg gttatactgg acaacactgt 901 gaaaaaaagg actacagtgt tctatacgtt gttcccggtc ctgtacgatt tcagtatgtc 961 ttaatcgcag ctgtgattgg aacaattcag attgctgtca tctgtgtggt ggtcctctgc 1021 atcacaaggg ccaaacttta a //