LOCUS       CR457386                 426 bp    mRNA    linear   HUM 03-JUN-2004
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834F0510D for
            gene DKFZP586N0721, DKFZP586N0721 protein; complete cds, incl.
            stopcodon.
ACCESSION   CR457386
VERSION     CR457386.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 426)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 426)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834F0510D, ORFNo 2549
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834F0510D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence NM_015400 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..426
                     /db_xref="H-InvDB:HIT000268236"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834F0510D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..426
                     /codon_start=1
                     /gene="DKFZP586N0721"
                     /db_xref="H-InvDB:HIT000268236.13"
                     /db_xref="UniProtKB/TrEMBL:Q6I9W9"
                     /protein_id="CAG33667.1"
                     /translation="MACTYVSNLGKKQRSVSFLASGLMRVSTGPELRLHHSFVLTGDV
                     GRRICRLLVGLFTKGDTSSKRVHPFSPGPCFLLCDLARVGSSPKINVSPFYQNQTSTQ
                     RSCTVFVWQRCSLVGPFQVTVFTMYFHHSLRSISRFSSG"
BASE COUNT          106 a          105 c          104 g          111 t
ORIGIN      
        1 atggcatgca cgtatgtaag taatctgggg aagaagcaaa gatctgtttc attcttagcc
       61 tcaggcctca tgagggtctc cacagggccg gagctcaggt tacaccactc cttcgtcctt
      121 acaggagatg tagggagaag aatctgcagg ctgcttgtag gactgttcac caagggggat
      181 accagcagca agagagtgca cccgtttagc cctggaccct gtttcttact gtgtgacttg
      241 gctagagttg ggagttcccc caaaataaac gtgtccccat tttaccagaa ccaaacctca
      301 acacagcgaa gctgtactgt ctttgtgtgg caaagatgtt cccttgtagg cccctttcag
      361 gtaaccgtct tcacaatgta ttttcatcac agtttaagga gcatcagccg cttctcaagt
      421 ggttaa
//