LOCUS CR457386 426 bp mRNA linear HUM 03-JUN-2004 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834F0510D for gene DKFZP586N0721, DKFZP586N0721 protein; complete cds, incl. stopcodon. ACCESSION CR457386 VERSION CR457386.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 426) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 426) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834F0510D, ORFNo 2549 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834F0510D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_015400 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..426 /db_xref="H-InvDB:HIT000268236" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834F0510D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..426 /codon_start=1 /gene="DKFZP586N0721" /db_xref="H-InvDB:HIT000268236.13" /db_xref="UniProtKB/TrEMBL:Q6I9W9" /protein_id="CAG33667.1" /translation="MACTYVSNLGKKQRSVSFLASGLMRVSTGPELRLHHSFVLTGDV GRRICRLLVGLFTKGDTSSKRVHPFSPGPCFLLCDLARVGSSPKINVSPFYQNQTSTQ RSCTVFVWQRCSLVGPFQVTVFTMYFHHSLRSISRFSSG" BASE COUNT 106 a 105 c 104 g 111 t ORIGIN 1 atggcatgca cgtatgtaag taatctgggg aagaagcaaa gatctgtttc attcttagcc 61 tcaggcctca tgagggtctc cacagggccg gagctcaggt tacaccactc cttcgtcctt 121 acaggagatg tagggagaag aatctgcagg ctgcttgtag gactgttcac caagggggat 181 accagcagca agagagtgca cccgtttagc cctggaccct gtttcttact gtgtgacttg 241 gctagagttg ggagttcccc caaaataaac gtgtccccat tttaccagaa ccaaacctca 301 acacagcgaa gctgtactgt ctttgtgtgg caaagatgtt cccttgtagg cccctttcag 361 gtaaccgtct tcacaatgta ttttcatcac agtttaagga gcatcagccg cttctcaagt 421 ggttaa //