LOCUS       CR457341                 678 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834B0410D for
            gene HDAC11, histone deacetylase 11; complete cds, incl. stopcodon.
ACCESSION   CR457341
VERSION     CR457341.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 678)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 678)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834B0410D, ORFNo 2426
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834B0410D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence AK025426 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..678
                     /db_xref="H-InvDB:HIT000268191"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834B0410D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..678
                     /codon_start=1
                     /gene="HDAC11"
                     /db_xref="GOA:Q6IA14"
                     /db_xref="H-InvDB:HIT000268191.12"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR023696"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="InterPro:IPR037138"
                     /db_xref="UniProtKB/TrEMBL:Q6IA14"
                     /protein_id="CAG33622.1"
                     /translation="MAGKLAVERGWAINVGGGFHHCSSDRGGGFCAYADITLAIKFLF
                     ERVEGISRATIIDLDAHQGNGHERDFMDDKRVYIMDVYNRHIYPGDRFAKQAIRRKVE
                     LEWGTEDDEYLDKVERNIKKSLQEHLPDVVVYNAGTDILEGDRLGGLSISPAGIVKRD
                     ELVFRMVRGRRVPILMVTSGGYQKRTARIIADSILNLFGLGLIGPESPSVSAQNSDTP
                     LLPPAVP"
BASE COUNT          137 a          190 c          218 g          133 t
ORIGIN      
        1 atggcgggga agctggctgt ggagcgaggc tgggccatca acgtgggggg tggcttccac
       61 cactgctcca gcgaccgtgg cgggggcttc tgtgcctatg cggacatcac gctcgccatc
      121 aagtttctgt ttgagcgtgt ggagggcatc tccagggcta ccatcattga tcttgatgcc
      181 catcagggca atgggcatga gcgagacttc atggacgaca agcgtgtgta catcatggat
      241 gtctacaacc gccacatcta cccaggggac cgctttgcca agcaggccat caggcggaag
      301 gtggagctgg agtggggcac agaggatgat gagtacctgg ataaggtgga gaggaacatc
      361 aagaaatccc tccaggagca cctgcccgac gtggtggtat acaatgcagg caccgacatc
      421 ctcgaggggg accgccttgg ggggctgtcc atcagcccag cgggcatcgt gaagcgggat
      481 gagctggtgt tccggatggt ccgtggccgc cgggtgccca tccttatggt gacctcaggc
      541 gggtaccaga agcgcacagc ccgcatcatt gctgactcca tacttaatct gtttggcctg
      601 gggctcattg ggcctgagtc acccagcgtc tccgcacaga actcagacac accgctgctt
      661 ccccctgcag tgccttaa
//