LOCUS CR457341 678 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834B0410D for gene HDAC11, histone deacetylase 11; complete cds, incl. stopcodon. ACCESSION CR457341 VERSION CR457341.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 678) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 678) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834B0410D, ORFNo 2426 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834B0410D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence AK025426 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..678 /db_xref="H-InvDB:HIT000268191" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834B0410D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..678 /codon_start=1 /gene="HDAC11" /db_xref="GOA:Q6IA14" /db_xref="H-InvDB:HIT000268191.12" /db_xref="InterPro:IPR000286" /db_xref="InterPro:IPR023696" /db_xref="InterPro:IPR023801" /db_xref="InterPro:IPR037138" /db_xref="UniProtKB/TrEMBL:Q6IA14" /protein_id="CAG33622.1" /translation="MAGKLAVERGWAINVGGGFHHCSSDRGGGFCAYADITLAIKFLF ERVEGISRATIIDLDAHQGNGHERDFMDDKRVYIMDVYNRHIYPGDRFAKQAIRRKVE LEWGTEDDEYLDKVERNIKKSLQEHLPDVVVYNAGTDILEGDRLGGLSISPAGIVKRD ELVFRMVRGRRVPILMVTSGGYQKRTARIIADSILNLFGLGLIGPESPSVSAQNSDTP LLPPAVP" BASE COUNT 137 a 190 c 218 g 133 t ORIGIN 1 atggcgggga agctggctgt ggagcgaggc tgggccatca acgtgggggg tggcttccac 61 cactgctcca gcgaccgtgg cgggggcttc tgtgcctatg cggacatcac gctcgccatc 121 aagtttctgt ttgagcgtgt ggagggcatc tccagggcta ccatcattga tcttgatgcc 181 catcagggca atgggcatga gcgagacttc atggacgaca agcgtgtgta catcatggat 241 gtctacaacc gccacatcta cccaggggac cgctttgcca agcaggccat caggcggaag 301 gtggagctgg agtggggcac agaggatgat gagtacctgg ataaggtgga gaggaacatc 361 aagaaatccc tccaggagca cctgcccgac gtggtggtat acaatgcagg caccgacatc 421 ctcgaggggg accgccttgg ggggctgtcc atcagcccag cgggcatcgt gaagcgggat 481 gagctggtgt tccggatggt ccgtggccgc cgggtgccca tccttatggt gacctcaggc 541 gggtaccaga agcgcacagc ccgcatcatt gctgactcca tacttaatct gtttggcctg 601 gggctcattg ggcctgagtc acccagcgtc tccgcacaga actcagacac accgctgctt 661 ccccctgcag tgccttaa //