LOCUS       CR457333                 918 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834H0413D for
            gene REC14, recombination protein REC14; complete cds, incl.
            stopcodon.
ACCESSION   CR457333
VERSION     CR457333.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 918)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 918)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834H0413D, ORFNo 2405
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H0413D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence BC010080 we found amino acid
            exchange(s) at position (first base of changed triplet):
            685(ser->gly) 763(ser->asn)
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..918
                     /db_xref="H-InvDB:HIT000268183"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834H0413D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..918
                     /codon_start=1
                     /gene="REC14"
                     /db_xref="GOA:Q9GZS3"
                     /db_xref="H-InvDB:HIT000268183.12"
                     /db_xref="HGNC:HGNC:30300"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PDB:3OW8"
                     /db_xref="PDB:6GMH"
                     /db_xref="UniProtKB/Swiss-Prot:Q9GZS3"
                     /protein_id="CAG33614.1"
                     /translation="MTNQYGILFKQEQAHDDAIWSVAWGTNKKENSETVVTGSLDDLV
                     KVWKWRDERLDLQWSLEGHQLGVVSVDISHTLPIAASSSLDAHIRLWDLENGKQIKSI
                     DAGPVDAWTLAFSPDSQYLATGTHVGKVNIFGVESGKKEYSLDTRGKFILSIAYSPDG
                     KYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYD
                     VQHANLAGTLGGHASWVLNVAFCPDDTHFVSSSSDKNVKVWDVGTRTCVHTFFDHQDQ
                     VWGVKYNGNGSKIVSVGDDQEIHIYDCPI"
BASE COUNT          243 a          197 c          230 g          248 t
ORIGIN      
        1 atgaccaacc agtacggtat tctcttcaaa caagagcaag cccatgatga tgccatttgg
       61 tcagttgctt gggggacaaa caagaaggaa aactctgaga cagtggtcac aggctcccta
      121 gatgacctgg tgaaggtctg gaaatggcgt gatgagaggc tggacctaca gtggagtctg
      181 gagggacatc agctgggagt ggtgtctgtg gacatcagcc acaccctgcc cattgctgca
      241 tccagctctc ttgatgctca tattcgtctt tgggacttgg aaaatggcaa acagataaag
      301 tccatagatg caggacctgt ggatgcctgg actttggcct tttctcctga ttcccagtat
      361 ctggccacag gaactcatgt cgggaaagtg aacatttttg gtgtggaaag tgggaaaaag
      421 gaatattctt tggacacgag aggaaaattc attcttagta ttgcatatag tcctgatggg
      481 aaatacctag ccagtggagc catagatgga atcatcaata tttttgatat tgcaactgga
      541 aaacttctgc ataccctgga aggccatgcc atgcccattc gctccttgac cttttccccg
      601 gactcccagc tccttgtcac tgcttcagat gatggctaca tcaagatcta tgatgtacaa
      661 catgccaatt tggctggcac gctgggcggc catgcctcct gggtgctgaa cgttgcattc
      721 tgtcctgatg acactcactt tgtttccagt tcgtctgaca aaaatgtaaa agtttgggat
      781 gttggaacga ggacttgtgt tcacaccttc tttgatcacc aggatcaggt ctggggagta
      841 aaatacaatg gaaatggttc aaaaattgtg tctgttggag atgaccagga aattcacata
      901 tatgattgtc caatttaa
//