LOCUS CR457333 918 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834H0413D for gene REC14, recombination protein REC14; complete cds, incl. stopcodon. ACCESSION CR457333 VERSION CR457333.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 918) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 918) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834H0413D, ORFNo 2405 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H0413D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence BC010080 we found amino acid exchange(s) at position (first base of changed triplet): 685(ser->gly) 763(ser->asn) Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..918 /db_xref="H-InvDB:HIT000268183" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834H0413D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..918 /codon_start=1 /gene="REC14" /db_xref="GOA:Q9GZS3" /db_xref="H-InvDB:HIT000268183.12" /db_xref="HGNC:HGNC:30300" /db_xref="InterPro:IPR001680" /db_xref="InterPro:IPR015943" /db_xref="InterPro:IPR017986" /db_xref="InterPro:IPR019775" /db_xref="InterPro:IPR020472" /db_xref="InterPro:IPR036322" /db_xref="PDB:3OW8" /db_xref="PDB:6GMH" /db_xref="UniProtKB/Swiss-Prot:Q9GZS3" /protein_id="CAG33614.1" /translation="MTNQYGILFKQEQAHDDAIWSVAWGTNKKENSETVVTGSLDDLV KVWKWRDERLDLQWSLEGHQLGVVSVDISHTLPIAASSSLDAHIRLWDLENGKQIKSI DAGPVDAWTLAFSPDSQYLATGTHVGKVNIFGVESGKKEYSLDTRGKFILSIAYSPDG KYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYD VQHANLAGTLGGHASWVLNVAFCPDDTHFVSSSSDKNVKVWDVGTRTCVHTFFDHQDQ VWGVKYNGNGSKIVSVGDDQEIHIYDCPI" BASE COUNT 243 a 197 c 230 g 248 t ORIGIN 1 atgaccaacc agtacggtat tctcttcaaa caagagcaag cccatgatga tgccatttgg 61 tcagttgctt gggggacaaa caagaaggaa aactctgaga cagtggtcac aggctcccta 121 gatgacctgg tgaaggtctg gaaatggcgt gatgagaggc tggacctaca gtggagtctg 181 gagggacatc agctgggagt ggtgtctgtg gacatcagcc acaccctgcc cattgctgca 241 tccagctctc ttgatgctca tattcgtctt tgggacttgg aaaatggcaa acagataaag 301 tccatagatg caggacctgt ggatgcctgg actttggcct tttctcctga ttcccagtat 361 ctggccacag gaactcatgt cgggaaagtg aacatttttg gtgtggaaag tgggaaaaag 421 gaatattctt tggacacgag aggaaaattc attcttagta ttgcatatag tcctgatggg 481 aaatacctag ccagtggagc catagatgga atcatcaata tttttgatat tgcaactgga 541 aaacttctgc ataccctgga aggccatgcc atgcccattc gctccttgac cttttccccg 601 gactcccagc tccttgtcac tgcttcagat gatggctaca tcaagatcta tgatgtacaa 661 catgccaatt tggctggcac gctgggcggc catgcctcct gggtgctgaa cgttgcattc 721 tgtcctgatg acactcactt tgtttccagt tcgtctgaca aaaatgtaaa agtttgggat 781 gttggaacga ggacttgtgt tcacaccttc tttgatcacc aggatcaggt ctggggagta 841 aaatacaatg gaaatggttc aaaaattgtg tctgttggag atgaccagga aattcacata 901 tatgattgtc caatttaa //