LOCUS       CR457329                 651 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834E129D for
            gene MRPL24, mitochondrial ribosomal protein L24; complete cds,
            incl. stopcodon.
ACCESSION   CR457329
VERSION     CR457329.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 651)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 651)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834E129D, ORFNo 2392
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E129D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence NM_145729 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..651
                     /db_xref="H-InvDB:HIT000268179"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834E129D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..651
                     /codon_start=1
                     /gene="MRPL24"
                     /db_xref="GOA:Q96A35"
                     /db_xref="H-InvDB:HIT000268179.12"
                     /db_xref="HGNC:HGNC:14037"
                     /db_xref="InterPro:IPR003256"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR005825"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR041988"
                     /db_xref="PDB:3J7Y"
                     /db_xref="PDB:3J9M"
                     /db_xref="PDB:5OOL"
                     /db_xref="PDB:5OOM"
                     /db_xref="PDB:6NU2"
                     /db_xref="PDB:6NU3"
                     /db_xref="UniProtKB/Swiss-Prot:Q96A35"
                     /protein_id="CAG33610.1"
                     /translation="MRLSALLALASKVTLPPHYRYGMSPPGSVADKRKNPPWIRRRPV
                     VVEPISDEDWYLFCGDTVEILEGKDAGKQGKVVQVIRQRNWVVVGGLNTHYRYIGKTM
                     DYRGTMIPSEAPLLHRQVKLVDPMDRKPTEIEWRFTEAGERVRVSTRSGRIIPKPEFP
                     RADGIVPETWIDGPKDTSVEDALERTYVPCLKTLQEEVMEAMGIKETRKYKKVYWY"
BASE COUNT          170 a          162 c          189 g          130 t
ORIGIN      
        1 atgcgtcttt ctgccctgct ggccttggca tccaaggtca ctctgccccc ccattaccgc
       61 tatgggatga gccccccagg ctctgttgca gacaagagga agaacccccc atggatcagg
      121 cggcgcccag tggttgtgga acccatctct gatgaagact ggtatctgtt ctgtggggac
      181 acggtggaga tcctagaagg caaggatgcc gggaagcagg gcaaagtggt tcaagttatc
      241 cggcagcgaa actgggtggt cgtgggaggg ctgaacacac attaccgcta cattggcaag
      301 accatggatt accggggaac catgatccct agtgaagccc ccttgctcca ccgccaggtc
      361 aaacttgtgg atcctatgga caggaaaccc actgagatcg agtggagatt tactgaagca
      421 ggagagcggg tacgagtctc cacacgatca gggagaatta tccctaaacc cgaatttccc
      481 agagctgatg gcatcgtccc tgaaacgtgg attgatggcc ccaaagacac atcagtggaa
      541 gatgctttag aaagaaccta tgtgccctgt ctaaagacac tgcaggagga ggtgatggag
      601 gccatgggga tcaaggagac ccggaaatac aagaaggtct attggtatta a
//