LOCUS CR457329 651 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834E129D for gene MRPL24, mitochondrial ribosomal protein L24; complete cds, incl. stopcodon. ACCESSION CR457329 VERSION CR457329.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 651) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 651) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834E129D, ORFNo 2392 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E129D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_145729 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..651 /db_xref="H-InvDB:HIT000268179" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834E129D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..651 /codon_start=1 /gene="MRPL24" /db_xref="GOA:Q96A35" /db_xref="H-InvDB:HIT000268179.12" /db_xref="HGNC:HGNC:14037" /db_xref="InterPro:IPR003256" /db_xref="InterPro:IPR005824" /db_xref="InterPro:IPR005825" /db_xref="InterPro:IPR008991" /db_xref="InterPro:IPR014722" /db_xref="InterPro:IPR041988" /db_xref="PDB:3J7Y" /db_xref="PDB:3J9M" /db_xref="PDB:5OOL" /db_xref="PDB:5OOM" /db_xref="PDB:6NU2" /db_xref="PDB:6NU3" /db_xref="UniProtKB/Swiss-Prot:Q96A35" /protein_id="CAG33610.1" /translation="MRLSALLALASKVTLPPHYRYGMSPPGSVADKRKNPPWIRRRPV VVEPISDEDWYLFCGDTVEILEGKDAGKQGKVVQVIRQRNWVVVGGLNTHYRYIGKTM DYRGTMIPSEAPLLHRQVKLVDPMDRKPTEIEWRFTEAGERVRVSTRSGRIIPKPEFP RADGIVPETWIDGPKDTSVEDALERTYVPCLKTLQEEVMEAMGIKETRKYKKVYWY" BASE COUNT 170 a 162 c 189 g 130 t ORIGIN 1 atgcgtcttt ctgccctgct ggccttggca tccaaggtca ctctgccccc ccattaccgc 61 tatgggatga gccccccagg ctctgttgca gacaagagga agaacccccc atggatcagg 121 cggcgcccag tggttgtgga acccatctct gatgaagact ggtatctgtt ctgtggggac 181 acggtggaga tcctagaagg caaggatgcc gggaagcagg gcaaagtggt tcaagttatc 241 cggcagcgaa actgggtggt cgtgggaggg ctgaacacac attaccgcta cattggcaag 301 accatggatt accggggaac catgatccct agtgaagccc ccttgctcca ccgccaggtc 361 aaacttgtgg atcctatgga caggaaaccc actgagatcg agtggagatt tactgaagca 421 ggagagcggg tacgagtctc cacacgatca gggagaatta tccctaaacc cgaatttccc 481 agagctgatg gcatcgtccc tgaaacgtgg attgatggcc ccaaagacac atcagtggaa 541 gatgctttag aaagaaccta tgtgccctgt ctaaagacac tgcaggagga ggtgatggag 601 gccatgggga tcaaggagac ccggaaatac aagaaggtct attggtatta a //