LOCUS CR457326 366 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834H109D for gene SLC35E1, solute carrier family 35, member E1; complete cds, incl. stopcodon. ACCESSION CR457326 VERSION CR457326.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 366) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 366) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834H109D, ORFNo 2381 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H109D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence AK024313 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..366 /db_xref="H-InvDB:HIT000268176" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834H109D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..366 /codon_start=1 /gene="SLC35E1" /db_xref="GOA:Q9H7U6" /db_xref="H-InvDB:HIT000268176.12" /db_xref="InterPro:IPR004853" /db_xref="UniProtKB/TrEMBL:Q9H7U6" /protein_id="CAG33607.1" /translation="MPIWVVLLSRIIMKEKQSTKVYLSLIPIISGVLLATVTELSFDM WGLVSALAATLCFSLQNIFSKKVLRDSRIHHLRLLNILGCHAVFFMIPTWVLVDLSAF LVSSDLVSCTAPRTRHFLG" BASE COUNT 68 a 114 c 87 g 97 t ORIGIN 1 atgcccatct gggtggtcct cctgtcccgg atcattatga aggagaagca gagcaccaag 61 gtatacttgt cactcatccc catcatcagc ggtgtcctgc tggccaccgt caccgagttg 121 tcttttgaca tgtggggact cgtcagcgcc ctcgccgcca cgctgtgctt ctcgcttcag 181 aacattttct ccaaaaaggt cttgcgagat tcacggatcc accatctccg gctgctcaac 241 atcctgggct gccacgccgt cttctttatg atccccacct gggttctggt ggacctctcg 301 gctttcctgg tcagcagcga cttggtgagt tgtacagcac caagaacacg ccattttctt 361 ggttaa //