LOCUS CR457325 777 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834G109D for gene C20orf39, chromosome 20 open reading frame 39; complete cds, incl. stopcodon. ACCESSION CR457325 VERSION CR457325.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 777) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 777) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834G109D, ORFNo 2380 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834G109D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_024893 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..777 /db_xref="H-InvDB:HIT000268175" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834G109D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..777 /codon_start=1 /gene="C20orf39" /db_xref="GOA:Q9H7V2" /db_xref="H-InvDB:HIT000268175.11" /db_xref="HGNC:HGNC:15885" /db_xref="InterPro:IPR007593" /db_xref="UniProtKB/Swiss-Prot:Q9H7V2" /protein_id="CAG33606.1" /translation="MDGIIEQKSMLVHSKISDAGKRNGLINTRNLMAESRDGLVSVYP APQYQSHRVGASTVPASLDSSRSEPMQQLLDPNTLQQSVESRYRPNIILYSEGVLRSW GDGVAADCCETTFIEDRSPTKDSLEYPDGKFIDLSADDIKIHTLSYDVEEEEEFQELE SDYSSDTESEDNFLMMPPRDHLGLSVFSMLCCFWPLGIAAFYLSHETNKAVAKGDLHQ ASTSSRRALFLAVLSITIGTGVYVGVAVALIAYLSKNNHL" BASE COUNT 174 a 234 c 224 g 145 t ORIGIN 1 atggatggca tcattgaaca gaagagcatg ctggtgcaca gtaaaatcag tgatgctggc 61 aagaggaatg gtttaattaa caccagaaac ttgatggccg agagcagaga tggtctggtg 121 tctgtttacc cagcgcccca gtaccagagc caccgggtgg gggccagcac agtgccggcc 181 agcctggaca gcagcaggag tgagccgatg cagcagctgc tggaccccaa caccctgcag 241 cagtcagtgg agtcccgcta ccggcccaac atcatcctct attcagaggg cgtgctgcgc 301 tcctgggggg acggtgtggc cgccgactgc tgcgagacca ccttcatcga ggaccggtcg 361 cccaccaaag acagcctcga gtacccggat gggaagttca ttgacctctc agctgatgac 421 ataaaaatcc acaccctgtc ctacgatgtg gaggaggagg aggagttcca ggagctggag 481 agcgactact caagcgacac agagagtgag gacaatttcc tcatgatgcc cccgcgggac 541 cacctgggcc tcagtgtctt ctccatgctc tgctgcttct ggcctctggg catcgcagcc 601 ttctacttgt cccatgagac caacaaagcc gtggccaagg gggacttgca ccaggccagc 661 accagctccc ggcgggccct attcctggca gtgctgtcca tcaccattgg gactggcgtc 721 tatgtgggcg tggccgtggc cctcatcgcc tacctctcca agaacaacca cctttaa //