LOCUS CR457313 1260 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834F0113D for gene PAF53, RNA polymerase I associated factor 53; complete cds, incl. stopcodon. ACCESSION CR457313 VERSION CR457313.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1260) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 1260) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834F0113D, ORFNo 2353 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834F0113D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_022490 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..1260 /db_xref="H-InvDB:HIT000268163" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834F0113D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..1260 /codon_start=1 /gene="PAF53" /db_xref="GOA:Q9GZS1" /db_xref="H-InvDB:HIT000268163.12" /db_xref="HGNC:HGNC:17631" /db_xref="InterPro:IPR009668" /db_xref="UniProtKB/Swiss-Prot:Q9GZS1" /protein_id="CAG33594.1" /translation="MAAEVLPSARWQYCGAPDGSQRAVLVQFSNGKLQSPGNMRFTLY ENKDSTNPRKRNQRILAAETDRLSYVGNNFGTGALKCNTLCRHFVGILNKTSGQMEVY DAELFNMQPLFSDVSVESELALESQTKTYREKMDSCIEAFGTTKQKRALNTRRMNRVG NESLNRAVAKAAETIIDTKGVTALVSDAIHNDLQDDSLYLPPCYDDAAKPEDVYKFED LLSPAEYEALQSPSEAFRNVTSEEILKMIEENSHCTFVIEALKSLPSDVESRDRQARC IWFLDTLIKFRAHRVVKRKSALGPGVPHIINTKLLKHFTCLTYNNGRLRNLISDSMKA KITAYVIILALHIHDFQIDLTVLQRDLKLSEKRMMEIAKAMRLKISKRRVSVAAGSEE DHKLGTLSLPLPPAQTSDRLAKRRKIT" BASE COUNT 360 a 287 c 323 g 290 t ORIGIN 1 atggcggcgg aggtgttgcc gagtgcgagg tggcagtatt gtggggcgcc cgacgggagc 61 cagagagctg tactggtcca gttctccaac gggaagctac agagtccagg caacatgcgc 121 tttaccttgt atgagaacaa agattccacc aaccccagga agaggaatca acggatcctg 181 gcagctgaaa cagataggct ctcctatgtg ggaaacaatt ttgggactgg agccctcaaa 241 tgcaacactt tgtgcaggca ctttgtggga attttgaaca agacctctgg ccaaatggaa 301 gtatatgatg ctgaattgtt caatatgcag ccactatttt cagatgtatc agttgagagt 361 gaactggcgc tagagagtca gaccaaaact tacagagaaa agatggattc ttgtattgaa 421 gcctttggta ccaccaaaca gaagcgagct ctgaacacca ggagaatgaa cagagttggc 481 aatgaatctt tgaatcgtgc agtggctaaa gctgcagaga ctatcattga tacgaagggt 541 gtgactgctc tggtcagcga tgctatccac aatgacttgc aagatgactc cctctacctt 601 cctccctgct atgatgatgc agccaagcct gaagacgtgt ataagtttga agatcttctt 661 tcccctgcgg agtatgaagc tcttcagagc ccatctgaag ctttcaggaa cgtcacgtca 721 gaagaaatac tgaagatgat tgaggagaac agccattgca cctttgtcat agaagcgttg 781 aagtctttgc catcagatgt ggagagccga gaccgccagg cccgatgcat atggtttctg 841 gataccctca tcaaatttcg agctcatagg gtagttaagc ggaaaagtgc tctgggacct 901 ggagttcccc acatcatcaa caccaaactg ctgaagcact ttacttgctt gacctacaac 961 aatggcagat tacggaactt aatttcggat tctatgaagg cgaagattac tgcatatgtg 1021 atcatacttg ccttgcacat acatgacttc caaattgacc tgacagtgtt acagagggac 1081 ttgaagctca gtgagaaaag gatgatggag atagccaaag ccatgaggct gaagatctcc 1141 aaaagaaggg tgtctgtggc cgccggcagt gaagaagatc acaaactggg caccctgtcc 1201 ctcccgctgc ctccagccca gacctcagac cgcctggcaa agcggaggaa gattacttaa //