LOCUS       CR457313                1260 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834F0113D for
            gene PAF53, RNA polymerase I associated factor 53; complete cds,
            incl. stopcodon.
ACCESSION   CR457313
VERSION     CR457313.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1260)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 1260)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834F0113D, ORFNo 2353
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834F0113D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence NM_022490 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..1260
                     /db_xref="H-InvDB:HIT000268163"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834F0113D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..1260
                     /codon_start=1
                     /gene="PAF53"
                     /db_xref="GOA:Q9GZS1"
                     /db_xref="H-InvDB:HIT000268163.12"
                     /db_xref="HGNC:HGNC:17631"
                     /db_xref="InterPro:IPR009668"
                     /db_xref="UniProtKB/Swiss-Prot:Q9GZS1"
                     /protein_id="CAG33594.1"
                     /translation="MAAEVLPSARWQYCGAPDGSQRAVLVQFSNGKLQSPGNMRFTLY
                     ENKDSTNPRKRNQRILAAETDRLSYVGNNFGTGALKCNTLCRHFVGILNKTSGQMEVY
                     DAELFNMQPLFSDVSVESELALESQTKTYREKMDSCIEAFGTTKQKRALNTRRMNRVG
                     NESLNRAVAKAAETIIDTKGVTALVSDAIHNDLQDDSLYLPPCYDDAAKPEDVYKFED
                     LLSPAEYEALQSPSEAFRNVTSEEILKMIEENSHCTFVIEALKSLPSDVESRDRQARC
                     IWFLDTLIKFRAHRVVKRKSALGPGVPHIINTKLLKHFTCLTYNNGRLRNLISDSMKA
                     KITAYVIILALHIHDFQIDLTVLQRDLKLSEKRMMEIAKAMRLKISKRRVSVAAGSEE
                     DHKLGTLSLPLPPAQTSDRLAKRRKIT"
BASE COUNT          360 a          287 c          323 g          290 t
ORIGIN      
        1 atggcggcgg aggtgttgcc gagtgcgagg tggcagtatt gtggggcgcc cgacgggagc
       61 cagagagctg tactggtcca gttctccaac gggaagctac agagtccagg caacatgcgc
      121 tttaccttgt atgagaacaa agattccacc aaccccagga agaggaatca acggatcctg
      181 gcagctgaaa cagataggct ctcctatgtg ggaaacaatt ttgggactgg agccctcaaa
      241 tgcaacactt tgtgcaggca ctttgtggga attttgaaca agacctctgg ccaaatggaa
      301 gtatatgatg ctgaattgtt caatatgcag ccactatttt cagatgtatc agttgagagt
      361 gaactggcgc tagagagtca gaccaaaact tacagagaaa agatggattc ttgtattgaa
      421 gcctttggta ccaccaaaca gaagcgagct ctgaacacca ggagaatgaa cagagttggc
      481 aatgaatctt tgaatcgtgc agtggctaaa gctgcagaga ctatcattga tacgaagggt
      541 gtgactgctc tggtcagcga tgctatccac aatgacttgc aagatgactc cctctacctt
      601 cctccctgct atgatgatgc agccaagcct gaagacgtgt ataagtttga agatcttctt
      661 tcccctgcgg agtatgaagc tcttcagagc ccatctgaag ctttcaggaa cgtcacgtca
      721 gaagaaatac tgaagatgat tgaggagaac agccattgca cctttgtcat agaagcgttg
      781 aagtctttgc catcagatgt ggagagccga gaccgccagg cccgatgcat atggtttctg
      841 gataccctca tcaaatttcg agctcatagg gtagttaagc ggaaaagtgc tctgggacct
      901 ggagttcccc acatcatcaa caccaaactg ctgaagcact ttacttgctt gacctacaac
      961 aatggcagat tacggaactt aatttcggat tctatgaagg cgaagattac tgcatatgtg
     1021 atcatacttg ccttgcacat acatgacttc caaattgacc tgacagtgtt acagagggac
     1081 ttgaagctca gtgagaaaag gatgatggag atagccaaag ccatgaggct gaagatctcc
     1141 aaaagaaggg tgtctgtggc cgccggcagt gaagaagatc acaaactggg caccctgtcc
     1201 ctcccgctgc ctccagccca gacctcagac cgcctggcaa agcggaggaa gattacttaa
//