LOCUS CR457293 999 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834B0913D for gene MRPL44, mitochondrial ribosomal protein L44; complete cds, incl. stopcodon. ACCESSION CR457293 VERSION CR457293.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 999) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 999) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834B0913D, ORFNo 2310 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834B0913D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_022915 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..999 /db_xref="H-InvDB:HIT000268143" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834B0913D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..999 /codon_start=1 /gene="MRPL44" /db_xref="GOA:Q9H9J2" /db_xref="H-InvDB:HIT000268143.11" /db_xref="HGNC:HGNC:16650" /db_xref="InterPro:IPR014720" /db_xref="InterPro:IPR036389" /db_xref="PDB:3J7Y" /db_xref="PDB:3J9M" /db_xref="PDB:5OOL" /db_xref="PDB:5OOM" /db_xref="PDB:6NU2" /db_xref="PDB:6NU3" /db_xref="UniProtKB/Swiss-Prot:Q9H9J2" /protein_id="CAG33574.1" /translation="MASGLVRLLQQGHRCLLAPVAPKLVPPVRGVKKGFRAAFRFQKE LERQRLLRCPPPPVRRSEKPNWDYHAEIQAFGHRLQENFSLDLLKTAFVNSCYIKSEE AKRQQLGIEKEAVLLNLKSNQELSEQGTSFSQTCLTQFLEDEYPDMPTEGIKNLVDFL TGEEVVCHVARNLAVEQLTLSEEFPVPPAVLQQTFFAVIGALLQSSGPERTALFIRDF LITQMTGKELFEMWKIINPMGLLVEELKKRNVSAPESRLTRQSGGTTALPLYFVGLYC DKKLIAEGPGETVLVAEEEAARVALRKLYGFTENRRPWNYSKPKETLRAEKSITAS" BASE COUNT 279 a 221 c 254 g 245 t ORIGIN 1 atggcgtccg ggctggtaag attgctgcag cagggacatc gctgcctcct ggctccagtc 61 gcccccaagc tggtccctcc ggttcgggga gtgaagaagg gattccgcgc cgccttccgc 121 ttccagaagg agttagagcg gcagcgcctt ctgcggtgcc cgccgccgcc cgtgcgccgt 181 tcagagaagc cgaactggga ttaccatgca gaaatacaag cttttggaca tcggttacag 241 gaaaactttt ccttagatct tctcaaaact gcatttgtta atagctgcta tattaaaagt 301 gaggaggcca aacgccaaca acttgggata gagaaagaag ctgttcttct gaatcttaaa 361 agtaatcaag aactatccga acaagggaca tctttttcac agacttgcct tacacagttt 421 cttgaagacg agtacccaga catgcccact gaaggcataa aaaatcttgt tgactttctc 481 actggtgagg aagtcgtgtg tcacgtggct agaaacttgg ctgtggagca gttaacactg 541 agtgaagaat tcccagtgcc cccagctgtg ttacagcaga ctttctttgc agttattgga 601 gccctgttac agagcagtgg acctgagagg actgcacttt tcatcaggga cttcttaatt 661 actcaaatga ctggaaaaga gctctttgag atgtggaaga taataaatcc catggggcta 721 ttggtagaag aactgaagaa aaggaatgtt tcagctcctg aatcaagact tactaggcag 781 tctggtggca ccacagcttt gcctttgtat tttgttggct tatactgtga taaaaagttg 841 attgcagaag gacctgggga aacagtattg gttgcagaag aagaggctgc tcgagtggcc 901 cttagaaaac tttatggatt cacagaaaat agacggccgt ggaactattc caagcccaaa 961 gaaaccttga gagcagaaaa gagcatcact gccagttaa //