LOCUS       CR457293                 999 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834B0913D for
            gene MRPL44, mitochondrial ribosomal protein L44; complete cds,
            incl. stopcodon.
ACCESSION   CR457293
VERSION     CR457293.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 999)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 999)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834B0913D, ORFNo 2310
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834B0913D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence NM_022915 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..999
                     /db_xref="H-InvDB:HIT000268143"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834B0913D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..999
                     /codon_start=1
                     /gene="MRPL44"
                     /db_xref="GOA:Q9H9J2"
                     /db_xref="H-InvDB:HIT000268143.11"
                     /db_xref="HGNC:HGNC:16650"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="InterPro:IPR036389"
                     /db_xref="PDB:3J7Y"
                     /db_xref="PDB:3J9M"
                     /db_xref="PDB:5OOL"
                     /db_xref="PDB:5OOM"
                     /db_xref="PDB:6NU2"
                     /db_xref="PDB:6NU3"
                     /db_xref="UniProtKB/Swiss-Prot:Q9H9J2"
                     /protein_id="CAG33574.1"
                     /translation="MASGLVRLLQQGHRCLLAPVAPKLVPPVRGVKKGFRAAFRFQKE
                     LERQRLLRCPPPPVRRSEKPNWDYHAEIQAFGHRLQENFSLDLLKTAFVNSCYIKSEE
                     AKRQQLGIEKEAVLLNLKSNQELSEQGTSFSQTCLTQFLEDEYPDMPTEGIKNLVDFL
                     TGEEVVCHVARNLAVEQLTLSEEFPVPPAVLQQTFFAVIGALLQSSGPERTALFIRDF
                     LITQMTGKELFEMWKIINPMGLLVEELKKRNVSAPESRLTRQSGGTTALPLYFVGLYC
                     DKKLIAEGPGETVLVAEEEAARVALRKLYGFTENRRPWNYSKPKETLRAEKSITAS"
BASE COUNT          279 a          221 c          254 g          245 t
ORIGIN      
        1 atggcgtccg ggctggtaag attgctgcag cagggacatc gctgcctcct ggctccagtc
       61 gcccccaagc tggtccctcc ggttcgggga gtgaagaagg gattccgcgc cgccttccgc
      121 ttccagaagg agttagagcg gcagcgcctt ctgcggtgcc cgccgccgcc cgtgcgccgt
      181 tcagagaagc cgaactggga ttaccatgca gaaatacaag cttttggaca tcggttacag
      241 gaaaactttt ccttagatct tctcaaaact gcatttgtta atagctgcta tattaaaagt
      301 gaggaggcca aacgccaaca acttgggata gagaaagaag ctgttcttct gaatcttaaa
      361 agtaatcaag aactatccga acaagggaca tctttttcac agacttgcct tacacagttt
      421 cttgaagacg agtacccaga catgcccact gaaggcataa aaaatcttgt tgactttctc
      481 actggtgagg aagtcgtgtg tcacgtggct agaaacttgg ctgtggagca gttaacactg
      541 agtgaagaat tcccagtgcc cccagctgtg ttacagcaga ctttctttgc agttattgga
      601 gccctgttac agagcagtgg acctgagagg actgcacttt tcatcaggga cttcttaatt
      661 actcaaatga ctggaaaaga gctctttgag atgtggaaga taataaatcc catggggcta
      721 ttggtagaag aactgaagaa aaggaatgtt tcagctcctg aatcaagact tactaggcag
      781 tctggtggca ccacagcttt gcctttgtat tttgttggct tatactgtga taaaaagttg
      841 attgcagaag gacctgggga aacagtattg gttgcagaag aagaggctgc tcgagtggcc
      901 cttagaaaac tttatggatt cacagaaaat agacggccgt ggaactattc caagcccaaa
      961 gaaaccttga gagcagaaaa gagcatcact gccagttaa
//