LOCUS       CR457279                 993 bp    mRNA    linear   HUM 17-APR-2005
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834A0813D for
            gene WDR5B, WD repeat domain 5B; complete cds, incl. stopcodon.
ACCESSION   CR457279
VERSION     CR457279.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 993)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 993)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834A0813D, ORFNo 2272
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834A0813D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence NM_019069 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..993
                     /db_xref="H-InvDB:HIT000268129"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834A0813D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..993
                     /codon_start=1
                     /gene="WDR5B"
                     /db_xref="GOA:Q86VZ2"
                     /db_xref="H-InvDB:HIT000268129.14"
                     /db_xref="HGNC:HGNC:17826"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="InterPro:IPR037866"
                     /db_xref="UniProtKB/Swiss-Prot:Q86VZ2"
                     /protein_id="CAG33560.1"
                     /translation="MATKESRDAKAQLALSSSANQSKEVPENPNYALKCTLVGHTEAV
                     SSVKFSPNGEWLASSSADRLIIIWGAYDGKYEKTLYGHNLEISDVAWSSDSSRLVSAS
                     DDKTLKLWDVRSGKCLKTLKGHSNYVFCCNFNPPSNLIISGSFDETVKIWEVKTGKCL
                     KTLSAHSDPVSAVHFNCSGSLIVSGSYDGLCRIWDAASGQCLKTLVDDDNPPVSFVKF
                     SPNGKYILTATLDNTLKLWDYSRGRCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSED
                     NLVYIWNLQTKEIVQKLQGHTDVVISAACHPTENLIASAALENDKTIKLWMSNH"
BASE COUNT          302 a          187 c          217 g          287 t
ORIGIN      
        1 atggcaacca aggagtcaag agacgccaaa gcacagttgg ccctctcctc atcggccaat
       61 cagagcaagg aagtgcctga aaacccaaac tatgctctca aatgtactct tgtgggacac
      121 acggaagcag tgtcatcagt taagtttagt cctaatggag aatggctagc aagttcttct
      181 gctgataggc taatcataat ttggggagca tatgatggaa aatatgagaa aacactctat
      241 ggtcataatt tggaaatatc ggatgttgcc tggtcatcag attccagtcg tcttgtttct
      301 gcctcagatg ataaaactct aaaattatgg gatgtgagat ctggaaaatg tttgaaaaca
      361 ctgaaggggc acagtaatta tgtcttttgt tgtaacttca atccgccatc caaccttata
      421 atctcgggat cttttgatga gactgtaaaa atatgggagg tgaaaacagg aaagtgtctc
      481 aagactttgt ctgctcattc tgacccagtt tctgctgttc attttaattg tagtgggtcc
      541 ttgatagtgt caggtagcta tgatggcctc tgtagaatct gggatgctgc atcaggtcag
      601 tgtttaaaaa cgctcgttga tgacgataac cctcctgtct cttttgtaaa attttctcca
      661 aatggtaaat acattctcac tgcaactttg gacaacactc ttaaactatg ggattatagc
      721 agaggcaggt gcctgaaaac atacactggt cataagaatg agaaatattg catatttgcc
      781 aatttttcag ttactggtgg aaagtggatt gtgtctggtt ccgaggataa cctggtttac
      841 atttggaacc ttcagactaa agagattgtg cagaaattac aaggccatac agatgttgtg
      901 atctcagcag cttgtcatcc tacagaaaac ctcatcgcat cagcagcatt agaaaatgac
      961 aaaacaatta aactgtggat gagtaaccat taa
//