LOCUS CR457275 456 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834E029D for gene FLJ11011, hypothetical protein FLJ11011; complete cds, incl. stopcodon. ACCESSION CR457275 VERSION CR457275.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 456) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 456) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834E029D, ORFNo 2254 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E029D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence BC016326 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..456 /db_xref="H-InvDB:HIT000268125" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834E029D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..456 /codon_start=1 /gene="FLJ11011" /db_xref="GOA:Q96B02" /db_xref="H-InvDB:HIT000268125.11" /db_xref="HGNC:HGNC:25616" /db_xref="InterPro:IPR000608" /db_xref="InterPro:IPR016135" /db_xref="PDB:2A7L" /db_xref="PDB:2MT6" /db_xref="UniProtKB/Swiss-Prot:Q96B02" /protein_id="CAG33556.1" /translation="MASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGA PGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSPA LSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPKKTKWWYHDDTC" BASE COUNT 145 a 88 c 88 g 135 t ORIGIN 1 atggcgtcaa tgcagaaacg actacagaaa gaactgttgg ctttgcaaaa tgacccacct 61 cctggaatga ccttaaatga gaagagtgtt caaaattcaa ttacacagtg gattgtagac 121 atggaaggtg caccaggtac cttatatgaa ggggaaaaat ttcaacttct atttaaattt 181 agtagtcgat atccttttga ctctcctcag gtcatgttta ctggtgaaaa tattcctgtt 241 catcctcatg tttatagcaa tggtcatatc tgtttatcca ttctaacaga agactggtcc 301 ccagcgctct cagtccaatc agtttgtctt agcattatta gcatgctttc cagctgcaag 361 gaaaagagac gaccaccgga taattctttt tatgtgcgaa catgtaacaa gaatccaaag 421 aaaacaaaat ggtggtatca tgatgatact tgttaa //