LOCUS       CR457271                1035 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834C0313D for
            gene NAGK, N-acetylglucosamine kinase; complete cds, incl.
            stopcodon.
ACCESSION   CR457271
VERSION     CR457271.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1035)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 1035)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834C0313D, ORFNo 2248
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834C0313D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence BC001029 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..1035
                     /db_xref="H-InvDB:HIT000268121"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834C0313D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..1035
                     /codon_start=1
                     /gene="NAGK"
                     /db_xref="GOA:Q9UJ70"
                     /db_xref="H-InvDB:HIT000268121.14"
                     /db_xref="HGNC:HGNC:17174"
                     /db_xref="InterPro:IPR002731"
                     /db_xref="InterPro:IPR039758"
                     /db_xref="PDB:2CH5"
                     /db_xref="PDB:2CH6"
                     /db_xref="UniProtKB/Swiss-Prot:Q9UJ70"
                     /protein_id="CAG33552.1"
                     /translation="MAAIYGGVEGGGTRSEVLLVSEDGKILAEADGLSTNHWLIGTDK
                     CVERINEMVNRAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSESY
                     LITTDAAGSIATATPDGGVVLISGTGSNCRLINPDGSESGCGGWGHMMGDEGSAYWIA
                     HQAVKIVFDSIDNLEAAPHDIGYVKQAMFHYFQVPDRLGILTHLYRDFDKCRFAGFCR
                     KIAEGAQQGDPLSRYIFRKAGEMLGRHIVAVLPEIDPVLFQGKIGLPILCVGSVWKSW
                     ELLKEGFLLALTQGREIQAQNFFSSFTLMKLRHSSALGGASLGARHIGHLLPMDYSAN
                     AIAFYSYTFS"
BASE COUNT          229 a          263 c          319 g          224 t
ORIGIN      
        1 atggccgcga tctatggggg tgtagagggg ggaggcacac gatccgaggt ccttttagtc
       61 tcagaggatg ggaagatcct ggcagaagca gatggactga gcacaaacca ctggctgatc
      121 gggacagaca agtgtgtgga gaggatcaat gagatggtga acagggccaa acggaaagcg
      181 ggggtggatc ctctggtacc gctgcgaagc ttgggcctat ctctgagcgg tggggaccag
      241 gaggacgcgg ggaggatcct gatcgaggag ctgagggacc gatttcccta cctgagtgaa
      301 agctacttaa tcaccaccga tgccgccggc tccatcgcca cagctacacc ggatggtgga
      361 gttgtgctca tatctggaac aggctccaac tgcaggctca tcaaccctga tggctccgag
      421 agtggctgcg gcggctgggg ccatatgatg ggtgatgagg gttcagccta ctggatcgca
      481 caccaagcag tgaaaatagt gtttgactcc attgacaacc tagaggcggc tcctcatgat
      541 atcggctacg tcaaacaggc catgttccac tatttccagg tgccagatcg gctagggata
      601 ctcactcacc tgtataggga ctttgataaa tgcaggtttg ctgggttttg ccggaaaatt
      661 gcagaaggtg ctcagcaggg agaccccctt tcccgctata tcttcaggaa ggctggggag
      721 atgctgggca gacacatcgt agcagtgttg cccgagattg acccggtctt gttccagggc
      781 aagattggac tccccatcct gtgcgtgggc tctgtgtgga agagctggga gctgctgaag
      841 gaaggttttc ttttggcgct gacccagggc agagagatcc aggctcagaa cttcttctcc
      901 agcttcaccc tgatgaagct gaggcactcc tccgctctgg gtggggccag cctaggggcc
      961 aggcacatcg ggcacctcct ccccatggac tatagcgcca atgccattgc cttctattcc
     1021 tacacctttt cttaa
//