LOCUS CR457271 1035 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834C0313D for gene NAGK, N-acetylglucosamine kinase; complete cds, incl. stopcodon. ACCESSION CR457271 VERSION CR457271.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1035) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 1035) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834C0313D, ORFNo 2248 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834C0313D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence BC001029 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..1035 /db_xref="H-InvDB:HIT000268121" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834C0313D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..1035 /codon_start=1 /gene="NAGK" /db_xref="GOA:Q9UJ70" /db_xref="H-InvDB:HIT000268121.14" /db_xref="HGNC:HGNC:17174" /db_xref="InterPro:IPR002731" /db_xref="InterPro:IPR039758" /db_xref="PDB:2CH5" /db_xref="PDB:2CH6" /db_xref="UniProtKB/Swiss-Prot:Q9UJ70" /protein_id="CAG33552.1" /translation="MAAIYGGVEGGGTRSEVLLVSEDGKILAEADGLSTNHWLIGTDK CVERINEMVNRAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSESY LITTDAAGSIATATPDGGVVLISGTGSNCRLINPDGSESGCGGWGHMMGDEGSAYWIA HQAVKIVFDSIDNLEAAPHDIGYVKQAMFHYFQVPDRLGILTHLYRDFDKCRFAGFCR KIAEGAQQGDPLSRYIFRKAGEMLGRHIVAVLPEIDPVLFQGKIGLPILCVGSVWKSW ELLKEGFLLALTQGREIQAQNFFSSFTLMKLRHSSALGGASLGARHIGHLLPMDYSAN AIAFYSYTFS" BASE COUNT 229 a 263 c 319 g 224 t ORIGIN 1 atggccgcga tctatggggg tgtagagggg ggaggcacac gatccgaggt ccttttagtc 61 tcagaggatg ggaagatcct ggcagaagca gatggactga gcacaaacca ctggctgatc 121 gggacagaca agtgtgtgga gaggatcaat gagatggtga acagggccaa acggaaagcg 181 ggggtggatc ctctggtacc gctgcgaagc ttgggcctat ctctgagcgg tggggaccag 241 gaggacgcgg ggaggatcct gatcgaggag ctgagggacc gatttcccta cctgagtgaa 301 agctacttaa tcaccaccga tgccgccggc tccatcgcca cagctacacc ggatggtgga 361 gttgtgctca tatctggaac aggctccaac tgcaggctca tcaaccctga tggctccgag 421 agtggctgcg gcggctgggg ccatatgatg ggtgatgagg gttcagccta ctggatcgca 481 caccaagcag tgaaaatagt gtttgactcc attgacaacc tagaggcggc tcctcatgat 541 atcggctacg tcaaacaggc catgttccac tatttccagg tgccagatcg gctagggata 601 ctcactcacc tgtataggga ctttgataaa tgcaggtttg ctgggttttg ccggaaaatt 661 gcagaaggtg ctcagcaggg agaccccctt tcccgctata tcttcaggaa ggctggggag 721 atgctgggca gacacatcgt agcagtgttg cccgagattg acccggtctt gttccagggc 781 aagattggac tccccatcct gtgcgtgggc tctgtgtgga agagctggga gctgctgaag 841 gaaggttttc ttttggcgct gacccagggc agagagatcc aggctcagaa cttcttctcc 901 agcttcaccc tgatgaagct gaggcactcc tccgctctgg gtggggccag cctaggggcc 961 aggcacatcg ggcacctcct ccccatggac tatagcgcca atgccattgc cttctattcc 1021 tacacctttt cttaa //