LOCUS CR457264 561 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834E019D for gene ARL10C, ADP-ribosylation factor-like 10C; complete cds, incl. stopcodon. ACCESSION CR457264 VERSION CR457264.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 561) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 561) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834E019D, ORFNo 2231 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E019D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_018184 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..561 /db_xref="H-InvDB:HIT000268114" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834E019D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..561 /codon_start=1 /gene="ARL10C" /db_xref="GOA:Q9NVJ2" /db_xref="H-InvDB:HIT000268114.12" /db_xref="HGNC:HGNC:25564" /db_xref="InterPro:IPR005225" /db_xref="InterPro:IPR006689" /db_xref="InterPro:IPR027417" /db_xref="PDB:2AL7" /db_xref="UniProtKB/Swiss-Prot:Q9NVJ2" /protein_id="CAG33545.1" /translation="MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQ FSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADRE KIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCY SISCKEKDNIDITLQWLIQHSKSRRS" BASE COUNT 176 a 109 c 135 g 141 t ORIGIN 1 atgctggcgc tcatctcccg cctgctggac tggttccgtt cgctcttctg gaaggaagag 61 atggagctga cgctcgtggg gctgcagtac tcgggcaaga ccaccttcgt caatgtcatc 121 gcgtcaggtc aattcagtga agatatgata cccacagtgg gcttcaacat gaggaaggta 181 actaaaggta acgtcacaat aaagatctgg gacataggag gacaaccccg atttcgaagc 241 atgtgggagc ggtattgcag aggagtcaat gctattgttt acatgataga tgctgcagat 301 cgtgaaaaga tagaagcttc ccgaaatgag ctacataatc ttctagataa accacagtta 361 caaggaattc cagtgctagt gcttggaaac aagagagatc ttcctaatgc cttggatgag 421 aaacagctaa ttgaaaaaat gaatctgtct gctattcagg atagagaaat ttgctgctat 481 tcaatttctt gcaaagaaaa ggataatata gatatcacac ttcagtggct tattcagcat 541 tcaaaatcta gaagaagtta a //