LOCUS       CR457264                 561 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834E019D for
            gene ARL10C, ADP-ribosylation factor-like 10C; complete cds, incl.
            stopcodon.
ACCESSION   CR457264
VERSION     CR457264.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 561)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 561)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834E019D, ORFNo 2231
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E019D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence NM_018184 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..561
                     /db_xref="H-InvDB:HIT000268114"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834E019D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..561
                     /codon_start=1
                     /gene="ARL10C"
                     /db_xref="GOA:Q9NVJ2"
                     /db_xref="H-InvDB:HIT000268114.12"
                     /db_xref="HGNC:HGNC:25564"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PDB:2AL7"
                     /db_xref="UniProtKB/Swiss-Prot:Q9NVJ2"
                     /protein_id="CAG33545.1"
                     /translation="MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQ
                     FSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADRE
                     KIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCY
                     SISCKEKDNIDITLQWLIQHSKSRRS"
BASE COUNT          176 a          109 c          135 g          141 t
ORIGIN      
        1 atgctggcgc tcatctcccg cctgctggac tggttccgtt cgctcttctg gaaggaagag
       61 atggagctga cgctcgtggg gctgcagtac tcgggcaaga ccaccttcgt caatgtcatc
      121 gcgtcaggtc aattcagtga agatatgata cccacagtgg gcttcaacat gaggaaggta
      181 actaaaggta acgtcacaat aaagatctgg gacataggag gacaaccccg atttcgaagc
      241 atgtgggagc ggtattgcag aggagtcaat gctattgttt acatgataga tgctgcagat
      301 cgtgaaaaga tagaagcttc ccgaaatgag ctacataatc ttctagataa accacagtta
      361 caaggaattc cagtgctagt gcttggaaac aagagagatc ttcctaatgc cttggatgag
      421 aaacagctaa ttgaaaaaat gaatctgtct gctattcagg atagagaaat ttgctgctat
      481 tcaatttctt gcaaagaaaa ggataatata gatatcacac ttcagtggct tattcagcat
      541 tcaaaatcta gaagaagtta a
//