LOCUS       CR457249                 918 bp    mRNA    linear   HUM 17-APR-2005
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834H0912D for
            gene FBXO34, F-box only protein 34; complete cds, incl. stopcodon.
ACCESSION   CR457249
VERSION     CR457249.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 918)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 918)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834H0912D, ORFNo 2195
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H0912D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence AK000732 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..918
                     /db_xref="H-InvDB:HIT000268099"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834H0912D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..918
                     /codon_start=1
                     /gene="FBXO34"
                     /db_xref="GOA:Q9NWN3"
                     /db_xref="H-InvDB:HIT000268099.13"
                     /db_xref="HGNC:HGNC:20201"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR036047"
                     /db_xref="InterPro:IPR039594"
                     /db_xref="UniProtKB/Swiss-Prot:Q9NWN3"
                     /protein_id="CAG33530.1"
                     /translation="MTDELVGLPFSSHTYSQASELPTDAVDCMSRELVSLTSRNPDQR
                     KESLCISITVSKVDKDQPSNLNSCEDPVPGMLFFLPPGQHLSDYSQLNESTTKESSEA
                     SQLEDAAGGDSASEEKSGSAEPFVPPASSVESTLPVLEASSWKKQVSHDFLETRFKIQ
                     QLLEPQQYMAFLPHHIMVKIFRLLPTKSLVALKCTCCYFKFIIEYYNIRPADSRWVRD
                     PRYREDPCKQCKKKYVKGDVSLCRWHPKPYCQALPYGPGYWMCCHRSQKGFPGCKLGL
                     HDNHWVPACHSFNRAIHKKAKGTEAEEEY"
BASE COUNT          244 a          215 c          220 g          239 t
ORIGIN      
        1 atgacagatg aactcgttgg gttacctttt tcctctcata cctattccca agcctctgaa
       61 ttgcccacag atgctgttga ttgtatgagc agagagcttg tgtcccttac tagccgaaat
      121 cctgatcaaa gaaaagaatc tttgtgcatt agtatcactg tgtccaaggt agacaaagac
      181 cagccttcca atttaaactc ctgtgaagac ccagttccag ggatgttgtt ttttttgcca
      241 cctggtcagc acttgtcaga ctattcccag ttgaatgaaa gcacaacaaa agagtcttca
      301 gaggccagcc agcttgaaga tgctgctggg ggtgacagtg catctgagga aaaaagtggg
      361 tctgctgagc catttgtacc gccagcctct tctgtggaaa gtacattacc agtgcttgag
      421 gcatccagtt ggaagaagca ggtgtcgcat gacttcctgg agaccaggtt taaaatccag
      481 cagcttttgg agcctcagca gtacatggct tttctgcccc accacattat ggtaaaaatc
      541 ttcaggttac ttcccaccaa gagtttagtg gcccttaaat gtacctgctg ctatttcaag
      601 tttatcattg agtactacaa tatcaggcca gcagattctc gctgggttcg agatccacgc
      661 tatagagagg atccttgcaa acagtgcaag aaaaagtatg tgaaagggga tgtgtccctg
      721 tgccgatggc accccaagcc ctattgccag gcattgccct atgggccagg gtattggatg
      781 tgctgccacc ggtctcagaa aggattccct ggctgtaagc tggggcttca tgacaatcac
      841 tgggttcctg cctgccacag ctttaatcgg gcaatccata agaaagcaaa agggactgaa
      901 gctgaagagg aatattaa
//