LOCUS CR457249 918 bp mRNA linear HUM 17-APR-2005 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834H0912D for gene FBXO34, F-box only protein 34; complete cds, incl. stopcodon. ACCESSION CR457249 VERSION CR457249.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 918) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 918) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834H0912D, ORFNo 2195 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H0912D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence AK000732 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..918 /db_xref="H-InvDB:HIT000268099" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834H0912D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..918 /codon_start=1 /gene="FBXO34" /db_xref="GOA:Q9NWN3" /db_xref="H-InvDB:HIT000268099.13" /db_xref="HGNC:HGNC:20201" /db_xref="InterPro:IPR001810" /db_xref="InterPro:IPR036047" /db_xref="InterPro:IPR039594" /db_xref="UniProtKB/Swiss-Prot:Q9NWN3" /protein_id="CAG33530.1" /translation="MTDELVGLPFSSHTYSQASELPTDAVDCMSRELVSLTSRNPDQR KESLCISITVSKVDKDQPSNLNSCEDPVPGMLFFLPPGQHLSDYSQLNESTTKESSEA SQLEDAAGGDSASEEKSGSAEPFVPPASSVESTLPVLEASSWKKQVSHDFLETRFKIQ QLLEPQQYMAFLPHHIMVKIFRLLPTKSLVALKCTCCYFKFIIEYYNIRPADSRWVRD PRYREDPCKQCKKKYVKGDVSLCRWHPKPYCQALPYGPGYWMCCHRSQKGFPGCKLGL HDNHWVPACHSFNRAIHKKAKGTEAEEEY" BASE COUNT 244 a 215 c 220 g 239 t ORIGIN 1 atgacagatg aactcgttgg gttacctttt tcctctcata cctattccca agcctctgaa 61 ttgcccacag atgctgttga ttgtatgagc agagagcttg tgtcccttac tagccgaaat 121 cctgatcaaa gaaaagaatc tttgtgcatt agtatcactg tgtccaaggt agacaaagac 181 cagccttcca atttaaactc ctgtgaagac ccagttccag ggatgttgtt ttttttgcca 241 cctggtcagc acttgtcaga ctattcccag ttgaatgaaa gcacaacaaa agagtcttca 301 gaggccagcc agcttgaaga tgctgctggg ggtgacagtg catctgagga aaaaagtggg 361 tctgctgagc catttgtacc gccagcctct tctgtggaaa gtacattacc agtgcttgag 421 gcatccagtt ggaagaagca ggtgtcgcat gacttcctgg agaccaggtt taaaatccag 481 cagcttttgg agcctcagca gtacatggct tttctgcccc accacattat ggtaaaaatc 541 ttcaggttac ttcccaccaa gagtttagtg gcccttaaat gtacctgctg ctatttcaag 601 tttatcattg agtactacaa tatcaggcca gcagattctc gctgggttcg agatccacgc 661 tatagagagg atccttgcaa acagtgcaag aaaaagtatg tgaaagggga tgtgtccctg 721 tgccgatggc accccaagcc ctattgccag gcattgccct atgggccagg gtattggatg 781 tgctgccacc ggtctcagaa aggattccct ggctgtaagc tggggcttca tgacaatcac 841 tgggttcctg cctgccacag ctttaatcgg gcaatccata agaaagcaaa agggactgaa 901 gctgaagagg aatattaa //