LOCUS       CR457243                1116 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834E0912D for
            gene C2orf18, chromosome 2 open reading frame 18; complete cds,
            incl. stopcodon.
ACCESSION   CR457243
VERSION     CR457243.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1116)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 1116)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834E0912D, ORFNo 2184
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E0912D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence NM_017877 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..1116
                     /db_xref="H-InvDB:HIT000268093"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834E0912D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..1116
                     /codon_start=1
                     /gene="C2orf18"
                     /db_xref="GOA:Q8N357"
                     /db_xref="H-InvDB:HIT000268093.12"
                     /db_xref="HGNC:HGNC:26055"
                     /db_xref="InterPro:IPR009262"
                     /db_xref="InterPro:IPR012404"
                     /db_xref="UniProtKB/Swiss-Prot:Q8N357"
                     /protein_id="CAG33524.1"
                     /translation="MAWTKYQLFLAGLMLVTGSINTLSAKWADNFMAEGCGGSKEHSF
                     QHPFLQAVGMFLGEFSCLAAFYLLRCRAAGQSDSSVDPQQPFNPLLFLPPALCDMTGT
                     SLMYVALNMTSASSFQMLRGAVIIFTGLFSVAFLGRRLVLSQWLGILATIAGLVVVGL
                     ADLLSKHDSQHKLSEVITGDLLIIMAQIIVAIQMVLEEKFVYKHNVHPLRAVGTEGLF
                     GFVILSLLLVPMYYIPAGSFSGNPRGTLEDALDAFCQVGQQPLIAVALLGNISSIAFF
                     NFAGISVTKELSATTRMVLDSLRTVVIWALSLALGWEAFHALQILGFLILLIGTALYN
                     GLHRPLLGRLSRGRPLAEESEQERLLGGTRTPINDAS"
BASE COUNT          206 a          353 c          319 g          238 t
ORIGIN      
        1 atggcctgga ccaagtacca gctgttcctg gccgggctca tgcttgttac cggctccatc
       61 aacacgctct cggcaaaatg ggcggacaat ttcatggccg agggctgtgg agggagcaag
      121 gagcacagct tccagcatcc cttcctccag gcagtgggca tgttcctggg agaattctcc
      181 tgcctggctg ccttctacct cctccgatgc agagctgcag ggcaatcaga ctccagcgta
      241 gacccccagc agcccttcaa ccctcttctt ttcctgcccc cagcgctctg tgacatgaca
      301 gggaccagcc tcatgtatgt ggctctgaac atgaccagtg cctccagctt ccagatgctg
      361 cggggtgcag tgatcatatt cactggcctg ttctcggtgg ccttcctggg ccggaggctg
      421 gtgctgagcc agtggctggg catcctagcc accatcgcgg ggctggtggt cgtgggcctg
      481 gctgacctcc tgagcaagca cgacagtcag cacaagctca gcgaagtgat cacaggggac
      541 ctgttgatca tcatggccca gatcatcgtt gccatccaga tggtgctaga ggagaagttc
      601 gtctacaaac acaatgtgca cccactgcgg gcagttggca ctgagggcct ctttggcttt
      661 gtgatcctct ccctgctgct ggtgcccatg tactacatcc ccgccggctc cttcagcgga
      721 aaccctcgtg ggacactgga ggatgcattg gacgccttct gccaggtggg ccagcagccg
      781 ctcattgccg tggcactgct gggcaacatc agcagcattg ccttcttcaa cttcgcaggc
      841 atcagcgtca ccaaggaact gagcgccacc acccgcatgg tgttggacag cttgcgcacc
      901 gttgtcatct gggcactgag cctggcactg ggctgggagg ccttccatgc actgcagatc
      961 cttggcttcc tcatactcct tataggcact gccctctaca atgggctaca ccgtccgctg
     1021 ctgggccgcc tgtccagggg ccggcccctg gcagaggaga gcgagcagga gagactgctg
     1081 ggtggcaccc gcactcccat caatgatgcc agttaa
//