LOCUS CR457243 1116 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834E0912D for gene C2orf18, chromosome 2 open reading frame 18; complete cds, incl. stopcodon. ACCESSION CR457243 VERSION CR457243.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1116) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 1116) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834E0912D, ORFNo 2184 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E0912D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_017877 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..1116 /db_xref="H-InvDB:HIT000268093" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834E0912D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..1116 /codon_start=1 /gene="C2orf18" /db_xref="GOA:Q8N357" /db_xref="H-InvDB:HIT000268093.12" /db_xref="HGNC:HGNC:26055" /db_xref="InterPro:IPR009262" /db_xref="InterPro:IPR012404" /db_xref="UniProtKB/Swiss-Prot:Q8N357" /protein_id="CAG33524.1" /translation="MAWTKYQLFLAGLMLVTGSINTLSAKWADNFMAEGCGGSKEHSF QHPFLQAVGMFLGEFSCLAAFYLLRCRAAGQSDSSVDPQQPFNPLLFLPPALCDMTGT SLMYVALNMTSASSFQMLRGAVIIFTGLFSVAFLGRRLVLSQWLGILATIAGLVVVGL ADLLSKHDSQHKLSEVITGDLLIIMAQIIVAIQMVLEEKFVYKHNVHPLRAVGTEGLF GFVILSLLLVPMYYIPAGSFSGNPRGTLEDALDAFCQVGQQPLIAVALLGNISSIAFF NFAGISVTKELSATTRMVLDSLRTVVIWALSLALGWEAFHALQILGFLILLIGTALYN GLHRPLLGRLSRGRPLAEESEQERLLGGTRTPINDAS" BASE COUNT 206 a 353 c 319 g 238 t ORIGIN 1 atggcctgga ccaagtacca gctgttcctg gccgggctca tgcttgttac cggctccatc 61 aacacgctct cggcaaaatg ggcggacaat ttcatggccg agggctgtgg agggagcaag 121 gagcacagct tccagcatcc cttcctccag gcagtgggca tgttcctggg agaattctcc 181 tgcctggctg ccttctacct cctccgatgc agagctgcag ggcaatcaga ctccagcgta 241 gacccccagc agcccttcaa ccctcttctt ttcctgcccc cagcgctctg tgacatgaca 301 gggaccagcc tcatgtatgt ggctctgaac atgaccagtg cctccagctt ccagatgctg 361 cggggtgcag tgatcatatt cactggcctg ttctcggtgg ccttcctggg ccggaggctg 421 gtgctgagcc agtggctggg catcctagcc accatcgcgg ggctggtggt cgtgggcctg 481 gctgacctcc tgagcaagca cgacagtcag cacaagctca gcgaagtgat cacaggggac 541 ctgttgatca tcatggccca gatcatcgtt gccatccaga tggtgctaga ggagaagttc 601 gtctacaaac acaatgtgca cccactgcgg gcagttggca ctgagggcct ctttggcttt 661 gtgatcctct ccctgctgct ggtgcccatg tactacatcc ccgccggctc cttcagcgga 721 aaccctcgtg ggacactgga ggatgcattg gacgccttct gccaggtggg ccagcagccg 781 ctcattgccg tggcactgct gggcaacatc agcagcattg ccttcttcaa cttcgcaggc 841 atcagcgtca ccaaggaact gagcgccacc acccgcatgg tgttggacag cttgcgcacc 901 gttgtcatct gggcactgag cctggcactg ggctgggagg ccttccatgc actgcagatc 961 cttggcttcc tcatactcct tataggcact gccctctaca atgggctaca ccgtccgctg 1021 ctgggccgcc tgtccagggg ccggcccctg gcagaggaga gcgagcagga gagactgctg 1081 ggtggcaccc gcactcccat caatgatgcc agttaa //