LOCUS CR457242 915 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834H0812D for gene FLJ20551, hypothetical protein FLJ20551; complete cds, incl. stopcodon. ACCESSION CR457242 VERSION CR457242.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 915) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 915) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834H0812D, ORFNo 2183 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H0812D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence BC013194 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..915 /db_xref="H-InvDB:HIT000268092" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834H0812D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..915 /codon_start=1 /gene="FLJ20551" /db_xref="GOA:Q96DW6" /db_xref="H-InvDB:HIT000268092.13" /db_xref="HGNC:HGNC:26054" /db_xref="InterPro:IPR018108" /db_xref="InterPro:IPR023395" /db_xref="InterPro:IPR030847" /db_xref="UniProtKB/Swiss-Prot:Q96DW6" /protein_id="CAG33523.1" /translation="MIQNSRPSLLQPQDVGDTVETLMLHPVIKAFLCGSISGTCSTLL FQPLDLLKTRLQTLQPSDHGSRRVGMLAVLLKVVRTESLLGLWKGMSPSIVRCVPGVG IYFGTLYSLKQYFLRGHPPTALESVMLGVGSRSVAGVCMSPITVIKTRYESGKYGYES IYAALRSIYHSEGHRGLFSGLTATLLRDAPFSGIYLMFYNQTKNIVPHDQVDATLIPI TNFSCGIFAGILASLVTQPADVIKTHMQLYPLKFQWIGQAVTLIFKDYGLRGFFQGGI PRALRRTLMAAMAWTVYEEMMAKMGLKS" BASE COUNT 204 a 236 c 229 g 246 t ORIGIN 1 atgattcaga actcacgtcc gtcgctgctg caaccccaag atgtcggaga cacggtggaa 61 acgcttatgt tacatccggt gatcaaggct ttcctgtgtg gctccatcag tgggacctgc 121 tctaccctcc ttttccaacc tctggatctc cttaaaacac gcctgcaaac cctccagccc 181 tcagatcatg ggtctagacg tgttgggatg ttggctgtac tcttgaaggt ggttcgcacg 241 gagagtcttt tgggcctttg gaaagggatg tccccttcca ttgtgagatg tgtccctggc 301 gttggaatct actttggcac tctctactct ttgaagcagt atttcttgcg aggccatccc 361 ccaaccgccc tggagtcagt catgctgggg gtgggctctc gctctgttgc aggggtctgt 421 atgtcaccta tcactgtaat caagacgcgc tatgagagtg ggaaatatgg ctatgagagt 481 atctacgctg ccctgaggag catctatcac agtgaggggc accggggcct cttcagtggc 541 ctgacagcaa ctctccttcg agatgcgccc ttctcaggaa tctacctgat gttttacaac 601 cagaccaaaa atatagtgcc tcatgaccag gtggatgcaa cccttattcc tattacaaat 661 ttcagctgtg ggatatttgc tggtattctg gcctcactgg taactcaacc tgcggatgtt 721 atcaaaactc atatgcagct ttatccactg aagtttcaat ggattggcca agcagtgaca 781 cttattttca aagactatgg actacgtggc ttcttccaag gtggcatccc ccgagccctc 841 cgcagaactc taatggcagc aatggcgtgg acggtgtatg aagagatgat ggccaagatg 901 ggcctgaagt cttaa //