LOCUS       CR457242                 915 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834H0812D for
            gene FLJ20551, hypothetical protein FLJ20551; complete cds, incl.
            stopcodon.
ACCESSION   CR457242
VERSION     CR457242.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 915)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 915)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834H0812D, ORFNo 2183
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H0812D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence BC013194 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..915
                     /db_xref="H-InvDB:HIT000268092"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834H0812D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..915
                     /codon_start=1
                     /gene="FLJ20551"
                     /db_xref="GOA:Q96DW6"
                     /db_xref="H-InvDB:HIT000268092.13"
                     /db_xref="HGNC:HGNC:26054"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="InterPro:IPR030847"
                     /db_xref="UniProtKB/Swiss-Prot:Q96DW6"
                     /protein_id="CAG33523.1"
                     /translation="MIQNSRPSLLQPQDVGDTVETLMLHPVIKAFLCGSISGTCSTLL
                     FQPLDLLKTRLQTLQPSDHGSRRVGMLAVLLKVVRTESLLGLWKGMSPSIVRCVPGVG
                     IYFGTLYSLKQYFLRGHPPTALESVMLGVGSRSVAGVCMSPITVIKTRYESGKYGYES
                     IYAALRSIYHSEGHRGLFSGLTATLLRDAPFSGIYLMFYNQTKNIVPHDQVDATLIPI
                     TNFSCGIFAGILASLVTQPADVIKTHMQLYPLKFQWIGQAVTLIFKDYGLRGFFQGGI
                     PRALRRTLMAAMAWTVYEEMMAKMGLKS"
BASE COUNT          204 a          236 c          229 g          246 t
ORIGIN      
        1 atgattcaga actcacgtcc gtcgctgctg caaccccaag atgtcggaga cacggtggaa
       61 acgcttatgt tacatccggt gatcaaggct ttcctgtgtg gctccatcag tgggacctgc
      121 tctaccctcc ttttccaacc tctggatctc cttaaaacac gcctgcaaac cctccagccc
      181 tcagatcatg ggtctagacg tgttgggatg ttggctgtac tcttgaaggt ggttcgcacg
      241 gagagtcttt tgggcctttg gaaagggatg tccccttcca ttgtgagatg tgtccctggc
      301 gttggaatct actttggcac tctctactct ttgaagcagt atttcttgcg aggccatccc
      361 ccaaccgccc tggagtcagt catgctgggg gtgggctctc gctctgttgc aggggtctgt
      421 atgtcaccta tcactgtaat caagacgcgc tatgagagtg ggaaatatgg ctatgagagt
      481 atctacgctg ccctgaggag catctatcac agtgaggggc accggggcct cttcagtggc
      541 ctgacagcaa ctctccttcg agatgcgccc ttctcaggaa tctacctgat gttttacaac
      601 cagaccaaaa atatagtgcc tcatgaccag gtggatgcaa cccttattcc tattacaaat
      661 ttcagctgtg ggatatttgc tggtattctg gcctcactgg taactcaacc tgcggatgtt
      721 atcaaaactc atatgcagct ttatccactg aagtttcaat ggattggcca agcagtgaca
      781 cttattttca aagactatgg actacgtggc ttcttccaag gtggcatccc ccgagccctc
      841 cgcagaactc taatggcagc aatggcgtgg acggtgtatg aagagatgat ggccaagatg
      901 ggcctgaagt cttaa
//