LOCUS CR457232 1008 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834E0712D for gene OSGEP, O-sialoglycoprotein endopeptidase; complete cds, incl. stopcodon. ACCESSION CR457232 VERSION CR457232.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1008) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 1008) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834E0712D, ORFNo 2153 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E0712D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_017807 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..1008 /db_xref="H-InvDB:HIT000268082" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834E0712D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..1008 /codon_start=1 /gene="OSGEP" /db_xref="GOA:Q9NPF4" /db_xref="H-InvDB:HIT000268082.11" /db_xref="HGNC:HGNC:18028" /db_xref="InterPro:IPR000905" /db_xref="InterPro:IPR017860" /db_xref="InterPro:IPR017861" /db_xref="InterPro:IPR034680" /db_xref="PDB:6GWJ" /db_xref="UniProtKB/Swiss-Prot:Q9NPF4" /protein_id="CAG33513.1" /translation="MPAVLGFEGSANKIGVGVVRDGKVLANPRRTYVTPPGTGFLPGD TARHHRAVILDLLQEALTESGLTSQDIDCIAYTKGPGMGAPLVSVAVVARTVAQLWNK PLVGVNHCIGHIEMGRLITGATSPTVLYVSGGNTQVIAYSEHRYRIFGETIDIAVGNC LDRFARVLKISNDPSPGYNIEQMAKRGKKLVELPYTVKGMDVSFSGILSFIEDVAHRM LATGECTPEDLCFSLQETVFAMLVEITERAMAHCGSQEALIVGGVGCNVRLQEMMATM CQERGARLFATDERFCIDNGAMIAQAGWEMFRAGHRTPLSDSGVTQRYRTDEVEVTWR D" BASE COUNT 233 a 227 c 315 g 233 t ORIGIN 1 atgccggcgg tgctgggttt tgaaggcagc gccaataaga ttggcgtggg cgtggtgcgg 61 gatggcaagg tgctggcgaa cccgcggcgg acttacgtca cgcctcctgg cacaggattc 121 cttccaggtg atacagccag gcatcaccga gctgttatcc tagacctgct gcaggaggca 181 ctaacagagt ctggattaac ctcccaggat atcgactgca ttgcatacac caagggccct 241 ggcatgggtg ccccactggt ttctgtggct gttgtggccc gtactgtggc ccaactgtgg 301 aataagccat tggtgggtgt gaaccactgt ataggccaca ttgagatggg ccgcctcatc 361 actggagcca ccagcccaac cgtgttgtat gtgagtggag gaaatacgca ggtgattgca 421 tactcggaac atcgttaccg tatctttggg gaaaccatcg atattgcagt gggtaattgt 481 ctggatcgtt ttgctcgagt gctgaagatt tctaacgacc caagtccagg atacaacatt 541 gaacagatgg caaagcgagg caagaagcta gttgagctgc catacactgt aaaggggatg 601 gacgtctcat tctcagggat cctgtctttc attgaggatg tagcccatcg gatgctggcc 661 acaggcgagt gtactcctga ggatctgtgt ttctccctgc aggaaactgt gtttgcaatg 721 ctggtagaga tcacagagcg agccatggca cattgtggct cccaggaggc cctcattgtg 781 ggaggagtgg ggtgtaatgt gaggctacag gagatgatgg caacaatgtg ccaggaacgt 841 ggagcccggc tttttgctac agatgagaga ttctgtattg acaatggagc gatgatagcc 901 caggctggct gggagatgtt tcgggctgga cacaggaccc cactcagtga ttctggggtt 961 acacagaggt atcggacaga tgaagtagag gtgacctgga gggattaa //