LOCUS CR457231 552 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834C039D for gene CKLFSF6, chemokine-like factor super family 6; complete cds, incl. stopcodon. ACCESSION CR457231 VERSION CR457231.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 552) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 552) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834C039D, ORFNo 2150 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834C039D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_017801 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..552 /db_xref="H-InvDB:HIT000268081" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834C039D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..552 /codon_start=1 /gene="CKLFSF6" /db_xref="GOA:Q9NX76" /db_xref="H-InvDB:HIT000268081.11" /db_xref="HGNC:HGNC:19177" /db_xref="InterPro:IPR008253" /db_xref="UniProtKB/Swiss-Prot:Q9NX76" /protein_id="CAG33512.1" /translation="MENGAVYSPTTEEDPGPARGPRSGLAAYFFMGRLPLLRRVLKGL QLLLSLLAFICEEVVSQCTLCGGLYFFEFVSCSAFLLSLLILIVYCTPFYERVDTTKV KSSDFYITLGTGCVFLLASIIFVSTHDRTSAEIAAIVFGFIASFMFLLDFITMLYEKR QESQLRKPENTTRAEALTEPLNA" BASE COUNT 126 a 124 c 130 g 172 t ORIGIN 1 atggagaacg gagcggtgta cagccccact acggaggagg acccgggccc cgccagaggc 61 ccccggagcg gcctcgctgc ctactttttc atgggccggc tcccattgct ccggcgcgtt 121 ctcaagggct tgcagctgtt gctgtctctg ctggccttca tctgtgaaga agttgtatca 181 caatgtactt tatgtggagg actttatttt tttgagtttg taagctgcag tgcctttctt 241 ctgagtctcc ttatactgat tgtgtattgc actccatttt atgagagagt tgataccaca 301 aaagtaaaat catcggattt ttatattact ttgggaacag gatgtgtgtt tttgttggca 361 tccatcattt ttgtttccac acatgacagg acttcagctg agattgctgc aattgtgttt 421 ggatttatag caagttttat gttcctactt gactttatca ctatgctgta tgaaaaacga 481 caggagtccc agctgagaaa acctgaaaat accactaggg ctgaagccct cactgagcca 541 cttaatgctt aa //