LOCUS       CR457224                 942 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834F0412D for
            gene ITLN1, intelectin 1 (galactofuranose binding); complete cds,
            incl. stopcodon.
ACCESSION   CR457224
VERSION     CR457224.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 942)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 942)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834F0412D, ORFNo 2117
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834F0412D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence AY358359 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..942
                     /db_xref="H-InvDB:HIT000268074"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834F0412D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..942
                     /codon_start=1
                     /gene="ITLN1"
                     /db_xref="GOA:Q8WWA0"
                     /db_xref="H-InvDB:HIT000268074.13"
                     /db_xref="HGNC:HGNC:18259"
                     /db_xref="InterPro:IPR002181"
                     /db_xref="InterPro:IPR014716"
                     /db_xref="InterPro:IPR036056"
                     /db_xref="PDB:4WMQ"
                     /db_xref="PDB:4WMY"
                     /db_xref="UniProtKB/Swiss-Prot:Q8WWA0"
                     /protein_id="CAG33505.1"
                     /translation="MNQLSFLLFLIATTRGWSTDEANTYFKEWTCSSSPSLPRSCKEI
                     KDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSS
                     QQGSKADYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQH
                     WRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQK
                     TASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEAS
                     PQQCGDFSGFDWSGYGTHVGYSSSREITEAAVLLFYR"
BASE COUNT          234 a          230 c          262 g          216 t
ORIGIN      
        1 atgaaccaac tcagcttcct gctgtttctc atagcgacca ccagaggatg gagtacagat
       61 gaggctaata cttacttcaa ggagtggacc tgttcttcgt ctccatctct gcccagaagc
      121 tgcaaggaaa tcaaagacga atgtcctagt gcatttgatg gcctgtattt tctccgcact
      181 gagaatggtg ttatctacca gaccttctgt gacatgacct ctgggggtgg cggctggacc
      241 ctggtggcca gcgtgcatga gaatgacatg cgtgggaagt gcacggtggg cgatcgctgg
      301 tccagtcagc agggcagcaa agcagactac ccagaggggg acggcaactg ggccaactac
      361 aacacctttg gatctgcaga ggcggccacg agcgatgact acaagaaccc tggctactac
      421 gacatccagg ccaaggacct gggcatctgg cacgtgccca ataagtcccc catgcagcac
      481 tggagaaaca gctccctgct gaggtaccgc acggacactg gcttcctcca gacactggga
      541 cataatctgt ttggcatcta ccagaaatat ccagtgaaat atggagaagg aaagtgttgg
      601 actgacaacg gcccggtgat ccctgtggtc tatgattttg gcgacgccca gaaaacagca
      661 tcttattact caccctatgg ccagcgggaa ttcactgcgg gatttgttca gttcagggta
      721 tttaataacg agagagcagc caacgccttg tgtgctggaa tgagggtcac cggatgtaac
      781 actgagcatc actgcattgg tggaggagga tactttccag aggccagtcc ccagcagtgt
      841 ggagattttt ctggttttga ttggagtgga tatggaactc atgttggtta cagcagcagc
      901 cgtgagataa ctgaggcagc tgtgcttcta ttctatcgtt aa
//