LOCUS CR457224 942 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834F0412D for gene ITLN1, intelectin 1 (galactofuranose binding); complete cds, incl. stopcodon. ACCESSION CR457224 VERSION CR457224.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 942) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 942) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834F0412D, ORFNo 2117 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834F0412D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence AY358359 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..942 /db_xref="H-InvDB:HIT000268074" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834F0412D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..942 /codon_start=1 /gene="ITLN1" /db_xref="GOA:Q8WWA0" /db_xref="H-InvDB:HIT000268074.13" /db_xref="HGNC:HGNC:18259" /db_xref="InterPro:IPR002181" /db_xref="InterPro:IPR014716" /db_xref="InterPro:IPR036056" /db_xref="PDB:4WMQ" /db_xref="PDB:4WMY" /db_xref="UniProtKB/Swiss-Prot:Q8WWA0" /protein_id="CAG33505.1" /translation="MNQLSFLLFLIATTRGWSTDEANTYFKEWTCSSSPSLPRSCKEI KDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSS QQGSKADYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQH WRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQK TASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEAS PQQCGDFSGFDWSGYGTHVGYSSSREITEAAVLLFYR" BASE COUNT 234 a 230 c 262 g 216 t ORIGIN 1 atgaaccaac tcagcttcct gctgtttctc atagcgacca ccagaggatg gagtacagat 61 gaggctaata cttacttcaa ggagtggacc tgttcttcgt ctccatctct gcccagaagc 121 tgcaaggaaa tcaaagacga atgtcctagt gcatttgatg gcctgtattt tctccgcact 181 gagaatggtg ttatctacca gaccttctgt gacatgacct ctgggggtgg cggctggacc 241 ctggtggcca gcgtgcatga gaatgacatg cgtgggaagt gcacggtggg cgatcgctgg 301 tccagtcagc agggcagcaa agcagactac ccagaggggg acggcaactg ggccaactac 361 aacacctttg gatctgcaga ggcggccacg agcgatgact acaagaaccc tggctactac 421 gacatccagg ccaaggacct gggcatctgg cacgtgccca ataagtcccc catgcagcac 481 tggagaaaca gctccctgct gaggtaccgc acggacactg gcttcctcca gacactggga 541 cataatctgt ttggcatcta ccagaaatat ccagtgaaat atggagaagg aaagtgttgg 601 actgacaacg gcccggtgat ccctgtggtc tatgattttg gcgacgccca gaaaacagca 661 tcttattact caccctatgg ccagcgggaa ttcactgcgg gatttgttca gttcagggta 721 tttaataacg agagagcagc caacgccttg tgtgctggaa tgagggtcac cggatgtaac 781 actgagcatc actgcattgg tggaggagga tactttccag aggccagtcc ccagcagtgt 841 ggagattttt ctggttttga ttggagtgga tatggaactc atgttggtta cagcagcagc 901 cgtgagataa ctgaggcagc tgtgcttcta ttctatcgtt aa //