LOCUS CR457221 426 bp mRNA linear HUM 03-JUN-2004 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834G108D for gene NOTCH1, Notch homolog 1, translocation-associated (Drosophila); complete cds, incl. stopcodon. ACCESSION CR457221 VERSION CR457221.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 426) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 426) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834G108D, ORFNo 2114 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834G108D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence AK000012 we found amino acid exchange(s) at position (first base of changed triplet): 301(gly->arg) Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..426 /db_xref="H-InvDB:HIT000268071" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834G108D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..426 /codon_start=1 /gene="NOTCH1" /db_xref="H-InvDB:HIT000268071.11" /db_xref="UniProtKB/TrEMBL:Q6IAD4" /protein_id="CAG33502.1" /translation="MSNMRCVDCGTCLGHTRRHPTLFWGKTLPGLTPVAAPAPQPAQC PPGSEEDAPATQPGPQLAGPDPPWAPVFCRRLARAGHIELCNAVGCVLWSCPRSPGRG HAVGQGLEGGGGCPWATPPSLGGADFCNTKYSLWQKKCL" BASE COUNT 79 a 128 c 136 g 83 t ORIGIN 1 atgtcaaaca tgagatgtgt ggactgtggc acttgcctgg gtcacacacg gaggcatcct 61 acccttttct ggggaaagac actgcctggg ctgaccccgg tggcggcccc agcacctcag 121 cctgcacagt gtcccccagg ttccgaagaa gatgctccag caacacagcc tgggccccag 181 ctcgcgggac ccgacccccc gtgggctccc gtgttttgta ggagacttgc cagagccggg 241 cacattgagc tgtgcaacgc cgtgggctgc gtcctttggt cctgtccccg cagccctggc 301 agggggcatg cggtcgggca ggggctggag ggaggcgggg gctgcccttg ggccacccct 361 cctagtttgg gaggagcaga tttttgcaat accaagtata gcctatggca gaaaaaatgt 421 ctttaa //