LOCUS CR457219 216 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834E0616D for gene UBE2Q, ubiquitin-conjugating enzyme E2Q (putative); complete cds, incl. stopcodon. ACCESSION CR457219 VERSION CR457219.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 216) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 216) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834E0616D, ORFNo 2101 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E0616D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence BC015316 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..216 /db_xref="H-InvDB:HIT000268069" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834E0616D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..216 /codon_start=1 /gene="UBE2Q" /db_xref="GOA:Q7Z7E8" /db_xref="H-InvDB:HIT000268069.13" /db_xref="HGNC:HGNC:15698" /db_xref="InterPro:IPR000608" /db_xref="InterPro:IPR016135" /db_xref="PDB:2QGX" /db_xref="UniProtKB/Swiss-Prot:Q7Z7E8" /protein_id="CAG33500.1" /translation="MELLTKQGWSSAYSIESVIMQISATLVKGKARVQFGANKSQYSL TRAQQSYKSLVQIHEKNGWYTPPKEDG" BASE COUNT 72 a 54 c 53 g 37 t ORIGIN 1 atggaacttc tcaccaaaca gggctggagc agtgcctact ccatagagtc agtgatcatg 61 cagatcagtg ccacactggt gaaggggaaa gcacgagtgc agtttggagc caacaaatct 121 caatacagtc tgacaagagc acagcagtcc tacaagtcct tggtgcagat ccacgaaaaa 181 aacggctggt acacaccccc aaaagaagac ggttaa //