LOCUS CR457195 660 bp mRNA linear HUM 03-JUN-2004 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834E058D for gene NUDT5, nudix (nucleoside diphosphate linked moiety X)-type motif 5; complete cds, incl. stopcodon. ACCESSION CR457195 VERSION CR457195.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 660) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 660) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834E058D, ORFNo 2042 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E058D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence AF155832 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..660 /db_xref="H-InvDB:HIT000268045" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834E058D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..660 /codon_start=1 /gene="NUDT5" /db_xref="GOA:Q9UKK9" /db_xref="H-InvDB:HIT000268045.12" /db_xref="HGNC:HGNC:8052" /db_xref="InterPro:IPR000086" /db_xref="InterPro:IPR015797" /db_xref="InterPro:IPR020084" /db_xref="InterPro:IPR020476" /db_xref="PDB:2DSB" /db_xref="PDB:2DSC" /db_xref="PDB:2DSD" /db_xref="PDB:3AC9" /db_xref="PDB:3ACA" /db_xref="PDB:3BM4" /db_xref="PDB:3L85" /db_xref="PDB:5NQR" /db_xref="PDB:5NWH" /db_xref="PDB:5QJ4" /db_xref="PDB:5QJ5" /db_xref="PDB:5QJ6" /db_xref="PDB:5QJ7" /db_xref="PDB:5QJ8" /db_xref="PDB:5QJ9" /db_xref="PDB:5QJA" /db_xref="PDB:5QJB" /db_xref="PDB:5QJC" /db_xref="PDB:5QJD" /db_xref="PDB:5QJE" /db_xref="PDB:5QJF" /db_xref="PDB:5QJG" /db_xref="PDB:5QJH" /db_xref="PDB:5QJI" /db_xref="PDB:5QJJ" /db_xref="PDB:5QJK" /db_xref="PDB:5QJL" /db_xref="PDB:5QJM" /db_xref="PDB:5QJN" /db_xref="PDB:5QJO" /db_xref="PDB:5QJP" /db_xref="PDB:5QJQ" /db_xref="PDB:5QJR" /db_xref="PDB:5QJS" /db_xref="PDB:5QJT" /db_xref="PDB:5QJU" /db_xref="PDB:5QJV" /db_xref="PDB:5QJW" /db_xref="PDB:5QJX" /db_xref="PDB:5QJY" /db_xref="PDB:5QJZ" /db_xref="PDB:5QK0" /db_xref="PDB:5QK1" /db_xref="PDB:5QK2" /db_xref="PDB:5QK3" /db_xref="PDB:5QK4" /db_xref="PDB:5QK5" /db_xref="PDB:5QK6" /db_xref="PDB:5QK7" /db_xref="PDB:5QK8" /db_xref="PDB:5QK9" /db_xref="PDB:5QKA" /db_xref="PDB:6GRU" /db_xref="UniProtKB/Swiss-Prot:Q9UKK9" /protein_id="CAG33476.1" /translation="MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTR TWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDG ETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKP KPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLK F" BASE COUNT 201 a 146 c 168 g 145 t ORIGIN 1 atggagagcc aagaaccaac ggaatcttct cagaatggca aacagtatat catttcagag 61 gagttaattt cagaaggaaa atgggtcaag cttgaaaaaa caacgtacat ggatcctact 121 ggtaaaacta gaacttggga atcagtgaaa cgtacaacca ggaaagagca gactgcggat 181 ggtgtcgcgg tcatccccgt gctgcagaga acacttcact atgagtgtat cgttctggtg 241 aaacagttcc gaccaccaat ggggggctac tgcatagagt tccctgcagg tctcatagat 301 gatggtgaaa ccccagaagc agctgctctc cgggagcttg aagaagaaac tggctacaaa 361 ggggacattg ccgaatgttc tccagcggtc tgtatggacc caggcttgtc aaactgtact 421 atacacatcg tgacagtcac cattaacgga gatgatgccg aaaacgcaag gccgaagcca 481 aagccagggg atggagagtt tgtggaagtc atttctttac ccaagaatga cctgctgcag 541 agacttgatg ctctggtagc tgaagaacat ctcacagtgg acgccagggt ctattcctac 601 gctctagcgc tgaaacatgc aaatgcaaag ccatttgaag tgcccttctt gaaattttaa //