LOCUS       CR457195                 660 bp    mRNA    linear   HUM 03-JUN-2004
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834E058D for
            gene NUDT5, nudix (nucleoside diphosphate linked moiety X)-type
            motif 5; complete cds, incl. stopcodon.
ACCESSION   CR457195
VERSION     CR457195.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 660)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 660)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834E058D, ORFNo 2042
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E058D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence AF155832 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..660
                     /db_xref="H-InvDB:HIT000268045"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834E058D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..660
                     /codon_start=1
                     /gene="NUDT5"
                     /db_xref="GOA:Q9UKK9"
                     /db_xref="H-InvDB:HIT000268045.12"
                     /db_xref="HGNC:HGNC:8052"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="InterPro:IPR020084"
                     /db_xref="InterPro:IPR020476"
                     /db_xref="PDB:2DSB"
                     /db_xref="PDB:2DSC"
                     /db_xref="PDB:2DSD"
                     /db_xref="PDB:3AC9"
                     /db_xref="PDB:3ACA"
                     /db_xref="PDB:3BM4"
                     /db_xref="PDB:3L85"
                     /db_xref="PDB:5NQR"
                     /db_xref="PDB:5NWH"
                     /db_xref="PDB:5QJ4"
                     /db_xref="PDB:5QJ5"
                     /db_xref="PDB:5QJ6"
                     /db_xref="PDB:5QJ7"
                     /db_xref="PDB:5QJ8"
                     /db_xref="PDB:5QJ9"
                     /db_xref="PDB:5QJA"
                     /db_xref="PDB:5QJB"
                     /db_xref="PDB:5QJC"
                     /db_xref="PDB:5QJD"
                     /db_xref="PDB:5QJE"
                     /db_xref="PDB:5QJF"
                     /db_xref="PDB:5QJG"
                     /db_xref="PDB:5QJH"
                     /db_xref="PDB:5QJI"
                     /db_xref="PDB:5QJJ"
                     /db_xref="PDB:5QJK"
                     /db_xref="PDB:5QJL"
                     /db_xref="PDB:5QJM"
                     /db_xref="PDB:5QJN"
                     /db_xref="PDB:5QJO"
                     /db_xref="PDB:5QJP"
                     /db_xref="PDB:5QJQ"
                     /db_xref="PDB:5QJR"
                     /db_xref="PDB:5QJS"
                     /db_xref="PDB:5QJT"
                     /db_xref="PDB:5QJU"
                     /db_xref="PDB:5QJV"
                     /db_xref="PDB:5QJW"
                     /db_xref="PDB:5QJX"
                     /db_xref="PDB:5QJY"
                     /db_xref="PDB:5QJZ"
                     /db_xref="PDB:5QK0"
                     /db_xref="PDB:5QK1"
                     /db_xref="PDB:5QK2"
                     /db_xref="PDB:5QK3"
                     /db_xref="PDB:5QK4"
                     /db_xref="PDB:5QK5"
                     /db_xref="PDB:5QK6"
                     /db_xref="PDB:5QK7"
                     /db_xref="PDB:5QK8"
                     /db_xref="PDB:5QK9"
                     /db_xref="PDB:5QKA"
                     /db_xref="PDB:6GRU"
                     /db_xref="UniProtKB/Swiss-Prot:Q9UKK9"
                     /protein_id="CAG33476.1"
                     /translation="MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTR
                     TWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDG
                     ETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKP
                     KPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLK
                     F"
BASE COUNT          201 a          146 c          168 g          145 t
ORIGIN      
        1 atggagagcc aagaaccaac ggaatcttct cagaatggca aacagtatat catttcagag
       61 gagttaattt cagaaggaaa atgggtcaag cttgaaaaaa caacgtacat ggatcctact
      121 ggtaaaacta gaacttggga atcagtgaaa cgtacaacca ggaaagagca gactgcggat
      181 ggtgtcgcgg tcatccccgt gctgcagaga acacttcact atgagtgtat cgttctggtg
      241 aaacagttcc gaccaccaat ggggggctac tgcatagagt tccctgcagg tctcatagat
      301 gatggtgaaa ccccagaagc agctgctctc cgggagcttg aagaagaaac tggctacaaa
      361 ggggacattg ccgaatgttc tccagcggtc tgtatggacc caggcttgtc aaactgtact
      421 atacacatcg tgacagtcac cattaacgga gatgatgccg aaaacgcaag gccgaagcca
      481 aagccagggg atggagagtt tgtggaagtc atttctttac ccaagaatga cctgctgcag
      541 agacttgatg ctctggtagc tgaagaacat ctcacagtgg acgccagggt ctattcctac
      601 gctctagcgc tgaaacatgc aaatgcaaag ccatttgaag tgcccttctt gaaattttaa
//