LOCUS CR457187 723 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834A128D for gene MS4A7, membrane-spanning 4-domains, subfamily A, member 7; complete cds, incl. stopcodon. ACCESSION CR457187 VERSION CR457187.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 723) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 723) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834A128D, ORFNo 2025 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834A128D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_021201 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..723 /db_xref="H-InvDB:HIT000268037" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834A128D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..723 /codon_start=1 /gene="MS4A7" /db_xref="GOA:Q9GZW8" /db_xref="H-InvDB:HIT000268037.12" /db_xref="HGNC:HGNC:13378" /db_xref="InterPro:IPR007237" /db_xref="InterPro:IPR030417" /db_xref="InterPro:IPR030423" /db_xref="UniProtKB/Swiss-Prot:Q9GZW8" /protein_id="CAG33468.1" /translation="MLLQSQTMGVSHSFTPKGITIPQREKPGHMYQNEDYLQNGLPTE TTVLGTVQILCCLLISSLGAILVFAPYPSHFNPAISTTLMSGYPFLGALCFGITGSLS IISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMVALRTASQHCGSEMDYLSSLP YSEYYYPIYEIKDCLLTSVSLTGVLVVMLIFTVLELLLAAYSSVFWWKQLYSNNPGSS FSSTQSQDHIQQVKKSSSRSWI" BASE COUNT 180 a 189 c 143 g 211 t ORIGIN 1 atgctattac aatcccaaac catgggggtt tctcacagct ttacaccaaa gggcatcact 61 atccctcaaa gagagaaacc tggacacatg taccaaaacg aagattacct gcagaacggg 121 ctgccaacag aaaccaccgt tcttgggact gtccagatcc tgtgttgcct gttgatttca 181 agtctggggg ccatcttggt ttttgctccc tacccctccc acttcaatcc agcaatttcc 241 accactttga tgtctgggta cccattttta ggagctctgt gttttggcat tactggatcc 301 ctctcaatta tctctggaaa acaatcaact aagccctttg acctgagcag cttgacctca 361 aatgcagtga gttctgttac tgcaggagca ggcctcttcc tccttgctga cagcatggta 421 gccctgagga ctgcctctca acattgtggc tcagaaatgg attatctatc ctcattgcct 481 tattcggagt actattatcc aatatatgaa atcaaagatt gtctcctgac cagtgtcagt 541 ttaacaggtg tcctagtggt gatgctcatc ttcactgtgc tggagctctt attagctgca 601 tacagttctg tcttttggtg gaaacagctc tactccaaca accctgggag ttcattttcc 661 tcgacccagt cacaagatca tatccaacag gtcaaaaaga gttcttcacg gtcttggatt 721 taa //