LOCUS       CR457187                 723 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834A128D for
            gene MS4A7, membrane-spanning 4-domains, subfamily A, member 7;
            complete cds, incl. stopcodon.
ACCESSION   CR457187
VERSION     CR457187.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 723)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 723)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834A128D, ORFNo 2025
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834A128D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence NM_021201 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..723
                     /db_xref="H-InvDB:HIT000268037"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834A128D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..723
                     /codon_start=1
                     /gene="MS4A7"
                     /db_xref="GOA:Q9GZW8"
                     /db_xref="H-InvDB:HIT000268037.12"
                     /db_xref="HGNC:HGNC:13378"
                     /db_xref="InterPro:IPR007237"
                     /db_xref="InterPro:IPR030417"
                     /db_xref="InterPro:IPR030423"
                     /db_xref="UniProtKB/Swiss-Prot:Q9GZW8"
                     /protein_id="CAG33468.1"
                     /translation="MLLQSQTMGVSHSFTPKGITIPQREKPGHMYQNEDYLQNGLPTE
                     TTVLGTVQILCCLLISSLGAILVFAPYPSHFNPAISTTLMSGYPFLGALCFGITGSLS
                     IISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMVALRTASQHCGSEMDYLSSLP
                     YSEYYYPIYEIKDCLLTSVSLTGVLVVMLIFTVLELLLAAYSSVFWWKQLYSNNPGSS
                     FSSTQSQDHIQQVKKSSSRSWI"
BASE COUNT          180 a          189 c          143 g          211 t
ORIGIN      
        1 atgctattac aatcccaaac catgggggtt tctcacagct ttacaccaaa gggcatcact
       61 atccctcaaa gagagaaacc tggacacatg taccaaaacg aagattacct gcagaacggg
      121 ctgccaacag aaaccaccgt tcttgggact gtccagatcc tgtgttgcct gttgatttca
      181 agtctggggg ccatcttggt ttttgctccc tacccctccc acttcaatcc agcaatttcc
      241 accactttga tgtctgggta cccattttta ggagctctgt gttttggcat tactggatcc
      301 ctctcaatta tctctggaaa acaatcaact aagccctttg acctgagcag cttgacctca
      361 aatgcagtga gttctgttac tgcaggagca ggcctcttcc tccttgctga cagcatggta
      421 gccctgagga ctgcctctca acattgtggc tcagaaatgg attatctatc ctcattgcct
      481 tattcggagt actattatcc aatatatgaa atcaaagatt gtctcctgac cagtgtcagt
      541 ttaacaggtg tcctagtggt gatgctcatc ttcactgtgc tggagctctt attagctgca
      601 tacagttctg tcttttggtg gaaacagctc tactccaaca accctgggag ttcattttcc
      661 tcgacccagt cacaagatca tatccaacag gtcaaaaaga gttcttcacg gtcttggatt
      721 taa
//