LOCUS CR457186 558 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834H038D for gene Pfs2, DNA replication complex GINS protein PSF2; complete cds, incl. stopcodon. ACCESSION CR457186 VERSION CR457186.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 558) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 558) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834H038D, ORFNo 2022 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H038D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence BC003186 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..558 /db_xref="H-InvDB:HIT000268036" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834H038D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..558 /codon_start=1 /gene="Pfs2" /db_xref="GOA:Q9Y248" /db_xref="H-InvDB:HIT000268036.11" /db_xref="HGNC:HGNC:24575" /db_xref="InterPro:IPR007257" /db_xref="InterPro:IPR021151" /db_xref="InterPro:IPR036224" /db_xref="PDB:2E9X" /db_xref="PDB:2EHO" /db_xref="PDB:2Q9Q" /db_xref="UniProtKB/Swiss-Prot:Q9Y248" /protein_id="CAG33467.1" /translation="MDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEV PLWLAINLKQRQKCRLLPPEWMDVEKLEKMRDHERKEETFTPMPSPYYMELTKLLLNH ASDNIPKADEIRTLVKDMWDTRIAKLRVSADSFVRQQEAHAKLDNLTLMEINTSGTFL TQALNHMYKLRTNLQPLESTQSQDF" BASE COUNT 156 a 148 c 137 g 117 t ORIGIN 1 atggacgctg ccgaggtcga attcctcgcc gagaaggagc tggttaccat tatccccaac 61 ttcagtctgg acaagatcta cctcatcggg ggggacctgg ggccttttaa ccctggttta 121 cccgtggaag tgcccctgtg gctggcgatt aacctgaaac aaagacagaa atgtcgcctg 181 ctccctccag agtggatgga tgtagaaaag ttggagaaga tgagggatca tgaacgaaag 241 gaagaaactt ttaccccaat gcccagccct tactacatgg aacttacgaa gctcctgtta 301 aatcatgctt cagacaacat cccgaaggca gacgaaatcc ggaccctggt caaggatatg 361 tgggacactc gtatagccaa actccgagtg tctgctgaca gctttgtgag acagcaggag 421 gcacatgcca agctggataa cttgaccttg atggagatca acaccagcgg gactttcctc 481 acacaagcgc tcaaccacat gtacaaactc cgcacaaacc tccagcctct ggagagtact 541 cagtctcagg acttttaa //