LOCUS CR457183 306 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834E038D for gene DC6, DC6 protein; complete cds, incl. stopcodon. ACCESSION CR457183 VERSION CR457183.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 306) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 306) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834E038D, ORFNo 2010 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E038D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_020189 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..306 /db_xref="H-InvDB:HIT000268033" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834E038D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..306 /codon_start=1 /gene="DC6" /db_xref="GOA:Q9NPA8" /db_xref="H-InvDB:HIT000268033.11" /db_xref="HGNC:HGNC:24449" /db_xref="InterPro:IPR018783" /db_xref="InterPro:IPR038212" /db_xref="PDB:4DHX" /db_xref="UniProtKB/Swiss-Prot:Q9NPA8" /protein_id="CAG33464.1" /translation="MVVSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKD QLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQHASL" BASE COUNT 113 a 51 c 79 g 63 t ORIGIN 1 atggtggtta gcaagatgaa caaagatgcg cagatgagag cagcgattaa ccaaaagttg 61 atagaaactg gagaaagaga acgcctcaaa gagttgctga gagctaaatt aattgaatgt 121 ggctggaagg atcagttgaa ggcacactgt aaagaggtaa ttaaagaaaa aggactagaa 181 cacgttactg ttgatgactt ggtggctgaa atcactccaa aaggcagagc cctggtacct 241 gacagtgtaa agaaggagct cctacaaaga ataagaacat tccttgctca gcatgccagc 301 ctttaa //