LOCUS CR457180 957 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834D0912D for gene RDH11, retinol dehydrogenase 11 (all-trans and 9-cis); complete cds, incl. stopcodon. ACCESSION CR457180 VERSION CR457180.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 957) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 957) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834D0912D, ORFNo 2006 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834D0912D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence AF151840 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..957 /db_xref="H-InvDB:HIT000268030" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834D0912D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..957 /codon_start=1 /gene="RDH11" /db_xref="GOA:Q8TC12" /db_xref="H-InvDB:HIT000268030.12" /db_xref="HGNC:HGNC:17964" /db_xref="InterPro:IPR002347" /db_xref="InterPro:IPR036291" /db_xref="UniProtKB/Swiss-Prot:Q8TC12" /protein_id="CAG33461.1" /translation="MVELMFPLLLLLLPFLLYMAAPQIRKMLSSGVCTSTVQLPGKVV VVTGANTGIGKETAKELAQRGARVYLACRDVEKGELVAKEIQTTTGNQQVLVRKLDLS DTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLL LEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKLANILFTQELAR RLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGL EILSGNHFSDCHVAWVSAQARNETIARRLWDVSCDLLGLPID" BASE COUNT 238 a 234 c 250 g 235 t ORIGIN 1 atggttgagc tcatgttccc gctgttgctc ctccttctgc ccttccttct gtatatggct 61 gcgccccaaa tcaggaaaat gctgtccagt ggggtgtgta catcaactgt tcagcttcct 121 gggaaagtag ttgtggtcac aggagctaat acaggtatcg ggaaggagac agccaaagag 181 ctggctcaga gaggagctcg agtatattta gcttgccggg atgtggaaaa gggggaattg 241 gtggccaaag agatccagac cacgacaggg aaccagcagg tgttggtgcg gaaactggac 301 ctgtctgata ctaagtctat tcgagctttt gctaagggct tcttagctga ggaaaagcac 361 ctccacgttt tgatcaacaa tgcaggagtg atgatgtgtc cgtactcgaa gacagcagat 421 ggctttgaga tgcacatagg agtcaaccac ttgggtcact tcctcctaac ccatctgctg 481 ctagagaaac taaaggaatc agccccatca aggatagtaa atgtgtcttc cctcgcacat 541 cacctgggaa ggatccactt ccataacttg cagggcgaga aattctacaa tgcaggcctg 601 gcctactgtc acagcaagct agccaacatc ctcttcaccc aggaactggc ccggagacta 661 aaaggctctg gcgttacgac gtattctgta caccctggca cagtccaatc tgaactggtt 721 cggcactcat ctttcatgag atggatgtgg tggcttttct cctttttcat caagactcct 781 cagcagggag cccagaccag cctgcactgt gccttaacag aaggtcttga gattctaagt 841 gggaatcatt tcagtgactg tcatgtggca tgggtctctg cccaagctcg taatgagact 901 atagcaaggc ggctgtggga cgtcagttgt gacctgctgg gcctcccaat agattaa //