LOCUS       CR457180                 957 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834D0912D for
            gene RDH11, retinol dehydrogenase 11 (all-trans and 9-cis);
            complete cds, incl. stopcodon.
ACCESSION   CR457180
VERSION     CR457180.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 957)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 957)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834D0912D, ORFNo 2006
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834D0912D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence AF151840 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..957
                     /db_xref="H-InvDB:HIT000268030"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834D0912D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..957
                     /codon_start=1
                     /gene="RDH11"
                     /db_xref="GOA:Q8TC12"
                     /db_xref="H-InvDB:HIT000268030.12"
                     /db_xref="HGNC:HGNC:17964"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="UniProtKB/Swiss-Prot:Q8TC12"
                     /protein_id="CAG33461.1"
                     /translation="MVELMFPLLLLLLPFLLYMAAPQIRKMLSSGVCTSTVQLPGKVV
                     VVTGANTGIGKETAKELAQRGARVYLACRDVEKGELVAKEIQTTTGNQQVLVRKLDLS
                     DTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLL
                     LEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKLANILFTQELAR
                     RLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGL
                     EILSGNHFSDCHVAWVSAQARNETIARRLWDVSCDLLGLPID"
BASE COUNT          238 a          234 c          250 g          235 t
ORIGIN      
        1 atggttgagc tcatgttccc gctgttgctc ctccttctgc ccttccttct gtatatggct
       61 gcgccccaaa tcaggaaaat gctgtccagt ggggtgtgta catcaactgt tcagcttcct
      121 gggaaagtag ttgtggtcac aggagctaat acaggtatcg ggaaggagac agccaaagag
      181 ctggctcaga gaggagctcg agtatattta gcttgccggg atgtggaaaa gggggaattg
      241 gtggccaaag agatccagac cacgacaggg aaccagcagg tgttggtgcg gaaactggac
      301 ctgtctgata ctaagtctat tcgagctttt gctaagggct tcttagctga ggaaaagcac
      361 ctccacgttt tgatcaacaa tgcaggagtg atgatgtgtc cgtactcgaa gacagcagat
      421 ggctttgaga tgcacatagg agtcaaccac ttgggtcact tcctcctaac ccatctgctg
      481 ctagagaaac taaaggaatc agccccatca aggatagtaa atgtgtcttc cctcgcacat
      541 cacctgggaa ggatccactt ccataacttg cagggcgaga aattctacaa tgcaggcctg
      601 gcctactgtc acagcaagct agccaacatc ctcttcaccc aggaactggc ccggagacta
      661 aaaggctctg gcgttacgac gtattctgta caccctggca cagtccaatc tgaactggtt
      721 cggcactcat ctttcatgag atggatgtgg tggcttttct cctttttcat caagactcct
      781 cagcagggag cccagaccag cctgcactgt gccttaacag aaggtcttga gattctaagt
      841 gggaatcatt tcagtgactg tcatgtggca tgggtctctg cccaagctcg taatgagact
      901 atagcaaggc ggctgtggga cgtcagttgt gacctgctgg gcctcccaat agattaa
//