LOCUS CR457179 492 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834D108D for gene C15orf15, chromosome 15 open reading frame 15; complete cds, incl. stopcodon. ACCESSION CR457179 VERSION CR457179.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 492) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 492) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834D108D, ORFNo 2004 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834D108D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_016304 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..492 /db_xref="H-InvDB:HIT000268029" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834D108D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..492 /codon_start=1 /gene="C15orf15" /db_xref="GOA:Q9UHA3" /db_xref="H-InvDB:HIT000268029.12" /db_xref="HGNC:HGNC:18479" /db_xref="InterPro:IPR000988" /db_xref="InterPro:IPR011017" /db_xref="InterPro:IPR023438" /db_xref="InterPro:IPR023442" /db_xref="InterPro:IPR038630" /db_xref="UniProtKB/Swiss-Prot:Q9UHA3" /protein_id="CAG33460.1" /translation="MRIEKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKR NPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPIKYQRELWNKTIDAMKRVEEIKQK RQAKFIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMVQQLQEDVDME DAP" BASE COUNT 186 a 84 c 111 g 111 t ORIGIN 1 atgcgtatcg aaaagtgtta tttctgttcg gggcccatct atcctggaca cggcatgatg 61 ttcgtccgca acgattgcaa ggtgttcaga ttttgcaaat ctaaatgtca taaaaacttt 121 aaaaagaagc gcaatcctcg caaagttagg tggaccaaag cattccggaa agcagctggt 181 aaagagctta cagtggataa ttcatttgaa tttgaaaaac gtagaaatga acctatcaaa 241 taccagcgag agctatggaa taaaactatt gatgcgatga agagagttga agaaatcaaa 301 cagaagcgcc aagctaaatt tataatgaac agattgaaga aaaataaaga gctacagaaa 361 gttcaggata tcaaagaagt caagcaaaac atccatctta tccgagcccc tcttgcaggc 421 aaagggaaac agttggaaga gaaaatggta cagcagttac aagaggatgt ggacatggaa 481 gatgctcctt aa //