LOCUS CR457149 423 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834C129D for gene LOC51248, hypothetical protein LOC51248; complete cds, incl. stopcodon. ACCESSION CR457149 VERSION CR457149.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 423) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 423) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834C129D, ORFNo 1941 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834C129D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_016484 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..423 /db_xref="H-InvDB:HIT000267999" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834C129D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..423 /codon_start=1 /gene="LOC51248" /db_xref="GOA:Q5EBL8" /db_xref="H-InvDB:HIT000267999.13" /db_xref="HGNC:HGNC:28034" /db_xref="InterPro:IPR001478" /db_xref="InterPro:IPR036034" /db_xref="UniProtKB/Swiss-Prot:Q5EBL8" /protein_id="CAG33430.1" /translation="MDSRIPYDDYPVVFLPAYENPPAWIPPHERVHHPDYNNELTQFL PRTITLKKPPGAQLGFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDF QDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTVH" BASE COUNT 112 a 107 c 103 g 101 t ORIGIN 1 atggacagcc ggattcctta tgatgactac ccggtggttt tcttgcctgc ctatgagaat 61 cctccagcat ggattcctcc tcatgagagg gtacaccacc cggactacaa caatgagttg 121 acccagtttc tgccccgaac catcacactg aagaagcctc ctggagctca gttgggattt 181 aacatccgag gaggaaaggc ctcccagcta ggcatcttca tctccaaggt gattcctgac 241 tctgatgcac atagagcagg actgcaggaa ggggaccaag ttctagctgt gaatgatgtg 301 gatttccaag atattgagca cagcaaggct gttgagatcc tgaagacagc tcgtgaaatc 361 agcatgcgtg tgcgcttctt tccctacaat tatcatcgcc aaaaagagag gactgtgcat 421 taa //