LOCUS CR457141 786 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834A028D for gene MASA, E-1 enzyme; complete cds, incl. stopcodon. ACCESSION CR457141 VERSION CR457141.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 786) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 786) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834A028D, ORFNo 1918 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834A028D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_021204 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..786 /db_xref="H-InvDB:HIT000267991" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834A028D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..786 /codon_start=1 /gene="MASA" /db_xref="GOA:Q9UHY7" /db_xref="H-InvDB:HIT000267991.11" /db_xref="HGNC:HGNC:24599" /db_xref="InterPro:IPR006439" /db_xref="InterPro:IPR023214" /db_xref="InterPro:IPR023943" /db_xref="InterPro:IPR027511" /db_xref="InterPro:IPR036412" /db_xref="PDB:1YNS" /db_xref="PDB:1ZS9" /db_xref="UniProtKB/Swiss-Prot:Q9UHY7" /protein_id="CAG33422.1" /translation="MVVLSVPAEVTVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQ THWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVDDLQQMIQAVVDNVCWQMS LDRKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVEAQ KLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREAS AAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST" BASE COUNT 215 a 165 c 221 g 185 t ORIGIN 1 atggtcgtgc tttcggtccc cgccgaagtc accgtgatcc tgttagatat cgaaggtacc 61 acaaccccga ttgctttcgt gaaggacatt ttatttcctt acatcgaaga aaatgttaaa 121 gagtatctgc agacacattg ggaagaagag gagtgccagc aggatgtcag tcttttgagg 181 aaacaggctg aagaggacgc ccacctggat ggggctgttc ctatccctgc agcatctggg 241 aatggagtgg atgatctgca acagatgatc caggccgtgg tagataatgt gtgctggcag 301 atgtccctgg atcgaaagac cactgcactc aaacagctgc agggccacat gtggagggcg 361 gcattcacag ctgggcgcat gaaagcagag ttctttgcag atgtagttcc agcagtcagg 421 aagtggagag aggccggaat gaaggtgtac atctattcct cagggagtgt ggaggcacag 481 aaactgttat tcgggcattc tacggaggga gatattcttg agcttgttga tggtcacttt 541 gataccaaga ttggacacaa agtagagagt gaaagttacc gaaagattgc agacagcatt 601 gggtgctcaa ccaacaacat tttgtttctg acagatgtta ctcgagaggc cagtgctgct 661 gaggaagcag atgtgcacgt agctgtggtg gtgagaccag gcaacgcagg attaacagat 721 gatgagaaga cttactacag cctcatcaca tccttcagtg aactatacct gccttcctca 781 acttaa //