LOCUS       CR457141                 786 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834A028D for
            gene MASA, E-1 enzyme; complete cds, incl. stopcodon.
ACCESSION   CR457141
VERSION     CR457141.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 786)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 786)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834A028D, ORFNo 1918
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834A028D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence NM_021204 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..786
                     /db_xref="H-InvDB:HIT000267991"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834A028D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..786
                     /codon_start=1
                     /gene="MASA"
                     /db_xref="GOA:Q9UHY7"
                     /db_xref="H-InvDB:HIT000267991.11"
                     /db_xref="HGNC:HGNC:24599"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023943"
                     /db_xref="InterPro:IPR027511"
                     /db_xref="InterPro:IPR036412"
                     /db_xref="PDB:1YNS"
                     /db_xref="PDB:1ZS9"
                     /db_xref="UniProtKB/Swiss-Prot:Q9UHY7"
                     /protein_id="CAG33422.1"
                     /translation="MVVLSVPAEVTVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQ
                     THWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVDDLQQMIQAVVDNVCWQMS
                     LDRKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVEAQ
                     KLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREAS
                     AAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST"
BASE COUNT          215 a          165 c          221 g          185 t
ORIGIN      
        1 atggtcgtgc tttcggtccc cgccgaagtc accgtgatcc tgttagatat cgaaggtacc
       61 acaaccccga ttgctttcgt gaaggacatt ttatttcctt acatcgaaga aaatgttaaa
      121 gagtatctgc agacacattg ggaagaagag gagtgccagc aggatgtcag tcttttgagg
      181 aaacaggctg aagaggacgc ccacctggat ggggctgttc ctatccctgc agcatctggg
      241 aatggagtgg atgatctgca acagatgatc caggccgtgg tagataatgt gtgctggcag
      301 atgtccctgg atcgaaagac cactgcactc aaacagctgc agggccacat gtggagggcg
      361 gcattcacag ctgggcgcat gaaagcagag ttctttgcag atgtagttcc agcagtcagg
      421 aagtggagag aggccggaat gaaggtgtac atctattcct cagggagtgt ggaggcacag
      481 aaactgttat tcgggcattc tacggaggga gatattcttg agcttgttga tggtcacttt
      541 gataccaaga ttggacacaa agtagagagt gaaagttacc gaaagattgc agacagcatt
      601 gggtgctcaa ccaacaacat tttgtttctg acagatgtta ctcgagaggc cagtgctgct
      661 gaggaagcag atgtgcacgt agctgtggtg gtgagaccag gcaacgcagg attaacagat
      721 gatgagaaga cttactacag cctcatcaca tccttcagtg aactatacct gccttcctca
      781 acttaa
//