LOCUS       CR457140                1347 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834D0412D for
            gene FBLN5, fibulin 5; complete cds, incl. stopcodon.
ACCESSION   CR457140
VERSION     CR457140.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1347)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 1347)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834D0412D, ORFNo 1915
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834D0412D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence NM_006329 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..1347
                     /db_xref="H-InvDB:HIT000267990"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834D0412D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..1347
                     /codon_start=1
                     /gene="FBLN5"
                     /db_xref="GOA:Q9UBX5"
                     /db_xref="H-InvDB:HIT000267990.13"
                     /db_xref="HGNC:HGNC:3602"
                     /db_xref="InterPro:IPR000152"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR001881"
                     /db_xref="InterPro:IPR009030"
                     /db_xref="InterPro:IPR013032"
                     /db_xref="InterPro:IPR018097"
                     /db_xref="InterPro:IPR026823"
                     /db_xref="InterPro:IPR037288"
                     /db_xref="UniProtKB/Swiss-Prot:Q9UBX5"
                     /protein_id="CAG33421.1"
                     /translation="MPGIKRILTVTILALCLPSPGNAQAQCTNGFDLDRQSGQCLDID
                     ECRTIPEACRGDMMCVNQNGGYLCIPRTNPVYRGPYSNPYSTPYSGPYPAAAPPLSAP
                     NYPTISRPLICRFGYQMDESNQCVDVDECATDSHQCNPTQICINTEGGYTCSCTDGYW
                     LLEGQCLDIDECRYGYCQQLCANVPGSYSCTCNPGFTLNEDGRSCQDVNECATENPCV
                     QTCVNTYGSFICRCDPGYELEEDGVHCSDMDECSFSEFLCQHECVNQPGTYFCSCPPG
                     YILLDDNRSCQDINECEHRNHTCNLQQTCYNLQGGFKCIDPIRCEEPYLRISDNRCMC
                     PAENPGCRDQPFTILYRDMDVVSGRSVPADIFQMQATTRYPGAYYIFQIKSGNEGREF
                     YMRQTGPISATLVMTRPIKGPREIQLDLEMITVNTVINFRGSSVIRLRIYVSQYPF"
BASE COUNT          330 a          387 c          326 g          304 t
ORIGIN      
        1 atgccaggaa taaaaaggat actcactgtt accattctgg ctctctgtct tccaagccct
       61 gggaatgcac aggcacagtg cacgaatggc tttgacctgg atcgccagtc aggacagtgt
      121 ttagatattg atgaatgccg aaccatcccc gaggcctgcc gaggagacat gatgtgtgtt
      181 aaccaaaatg gcgggtattt atgcattccc cggacaaacc ctgtgtatcg agggccctac
      241 tcgaacccct actcgacccc ctactcaggt ccgtacccag cagctgcccc accactctca
      301 gctccaaact atcccacgat ctccaggcct cttatatgcc gctttggata ccagatggat
      361 gaaagcaacc aatgtgtgga tgtggacgag tgtgcaacag attcccacca gtgcaacccc
      421 acccagatct gcatcaatac tgaaggcggg tacacctgct cctgcaccga cggatattgg
      481 cttctggaag gccagtgctt agacattgat gaatgtcgct atggttactg ccagcagctc
      541 tgtgcgaatg ttcctggatc ctattcttgt acatgcaacc ctggttttac cctcaatgag
      601 gatggaaggt cttgccaaga tgtgaacgag tgtgccaccg agaacccctg cgtgcaaacc
      661 tgcgtcaaca cctacggctc tttcatctgc cgctgtgacc caggatatga acttgaggaa
      721 gatggcgttc attgcagtga tatggacgag tgcagcttct ctgagttcct ctgccaacat
      781 gagtgtgtga accagcccgg cacatacttc tgctcctgcc ctccaggcta catcctgctg
      841 gatgacaacc gaagctgcca agacatcaac gaatgtgagc acaggaacca cacgtgcaac
      901 ctgcagcaga cgtgctacaa tttacaaggg ggcttcaaat gcatcgaccc catccgctgt
      961 gaggagcctt atctgaggat cagtgataac cgctgtatgt gtcctgctga gaaccctggc
     1021 tgcagagacc agccctttac catcttgtac cgggacatgg acgtggtgtc aggacgctcc
     1081 gttcccgctg acatcttcca aatgcaagcc acgacccgct accctggggc ctattacatt
     1141 ttccagatca aatctgggaa tgagggcaga gaattttaca tgcggcaaac gggccccatc
     1201 agtgccaccc tggtgatgac acgccccatc aaagggcccc gggaaatcca gctggacttg
     1261 gaaatgatca ctgtcaacac tgtcatcaac ttcagaggca gctccgtgat ccgactgcgg
     1321 atatatgtgt cgcagtaccc attttaa
//