LOCUS CR457140 1347 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834D0412D for gene FBLN5, fibulin 5; complete cds, incl. stopcodon. ACCESSION CR457140 VERSION CR457140.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1347) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 1347) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834D0412D, ORFNo 1915 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834D0412D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_006329 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..1347 /db_xref="H-InvDB:HIT000267990" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834D0412D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..1347 /codon_start=1 /gene="FBLN5" /db_xref="GOA:Q9UBX5" /db_xref="H-InvDB:HIT000267990.13" /db_xref="HGNC:HGNC:3602" /db_xref="InterPro:IPR000152" /db_xref="InterPro:IPR000742" /db_xref="InterPro:IPR001881" /db_xref="InterPro:IPR009030" /db_xref="InterPro:IPR013032" /db_xref="InterPro:IPR018097" /db_xref="InterPro:IPR026823" /db_xref="InterPro:IPR037288" /db_xref="UniProtKB/Swiss-Prot:Q9UBX5" /protein_id="CAG33421.1" /translation="MPGIKRILTVTILALCLPSPGNAQAQCTNGFDLDRQSGQCLDID ECRTIPEACRGDMMCVNQNGGYLCIPRTNPVYRGPYSNPYSTPYSGPYPAAAPPLSAP NYPTISRPLICRFGYQMDESNQCVDVDECATDSHQCNPTQICINTEGGYTCSCTDGYW LLEGQCLDIDECRYGYCQQLCANVPGSYSCTCNPGFTLNEDGRSCQDVNECATENPCV QTCVNTYGSFICRCDPGYELEEDGVHCSDMDECSFSEFLCQHECVNQPGTYFCSCPPG YILLDDNRSCQDINECEHRNHTCNLQQTCYNLQGGFKCIDPIRCEEPYLRISDNRCMC PAENPGCRDQPFTILYRDMDVVSGRSVPADIFQMQATTRYPGAYYIFQIKSGNEGREF YMRQTGPISATLVMTRPIKGPREIQLDLEMITVNTVINFRGSSVIRLRIYVSQYPF" BASE COUNT 330 a 387 c 326 g 304 t ORIGIN 1 atgccaggaa taaaaaggat actcactgtt accattctgg ctctctgtct tccaagccct 61 gggaatgcac aggcacagtg cacgaatggc tttgacctgg atcgccagtc aggacagtgt 121 ttagatattg atgaatgccg aaccatcccc gaggcctgcc gaggagacat gatgtgtgtt 181 aaccaaaatg gcgggtattt atgcattccc cggacaaacc ctgtgtatcg agggccctac 241 tcgaacccct actcgacccc ctactcaggt ccgtacccag cagctgcccc accactctca 301 gctccaaact atcccacgat ctccaggcct cttatatgcc gctttggata ccagatggat 361 gaaagcaacc aatgtgtgga tgtggacgag tgtgcaacag attcccacca gtgcaacccc 421 acccagatct gcatcaatac tgaaggcggg tacacctgct cctgcaccga cggatattgg 481 cttctggaag gccagtgctt agacattgat gaatgtcgct atggttactg ccagcagctc 541 tgtgcgaatg ttcctggatc ctattcttgt acatgcaacc ctggttttac cctcaatgag 601 gatggaaggt cttgccaaga tgtgaacgag tgtgccaccg agaacccctg cgtgcaaacc 661 tgcgtcaaca cctacggctc tttcatctgc cgctgtgacc caggatatga acttgaggaa 721 gatggcgttc attgcagtga tatggacgag tgcagcttct ctgagttcct ctgccaacat 781 gagtgtgtga accagcccgg cacatacttc tgctcctgcc ctccaggcta catcctgctg 841 gatgacaacc gaagctgcca agacatcaac gaatgtgagc acaggaacca cacgtgcaac 901 ctgcagcaga cgtgctacaa tttacaaggg ggcttcaaat gcatcgaccc catccgctgt 961 gaggagcctt atctgaggat cagtgataac cgctgtatgt gtcctgctga gaaccctggc 1021 tgcagagacc agccctttac catcttgtac cgggacatgg acgtggtgtc aggacgctcc 1081 gttcccgctg acatcttcca aatgcaagcc acgacccgct accctggggc ctattacatt 1141 ttccagatca aatctgggaa tgagggcaga gaattttaca tgcggcaaac gggccccatc 1201 agtgccaccc tggtgatgac acgccccatc aaagggcccc gggaaatcca gctggacttg 1261 gaaatgatca ctgtcaacac tgtcatcaac ttcagaggca gctccgtgat ccgactgcgg 1321 atatatgtgt cgcagtaccc attttaa //