LOCUS CR457137 573 bp mRNA linear HUM 03-JUN-2004 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834H127D for gene TNFAIP8, tumor necrosis factor, alpha-induced protein 8; complete cds, incl. stopcodon. ACCESSION CR457137 VERSION CR457137.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 573) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 573) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834H127D, ORFNo 1910 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H127D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_014350 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..573 /db_xref="H-InvDB:HIT000267987" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834H127D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..573 /codon_start=1 /gene="TNFAIP8" /db_xref="GOA:O95379" /db_xref="H-InvDB:HIT000267987.11" /db_xref="HGNC:HGNC:17260" /db_xref="InterPro:IPR008477" /db_xref="InterPro:IPR038355" /db_xref="UniProtKB/Swiss-Prot:O95379" /protein_id="CAG33418.1" /translation="MAVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLD ELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLA MTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFL AALYNPFGNFKPHLQKLCDGINKMLDEENI" BASE COUNT 186 a 111 c 126 g 150 t ORIGIN 1 atggcagtgg ccacagatgt ctttaattcc aaaaacctgg ccgttcaggc acaaaagaag 61 atcttgggta aaatggtgtc caaatccatc gccaccacct taatagacga cacaagtagt 121 gaggtgctgg atgagctcta cagagtgacc agggagtaca cccaaaacaa gaaggaggca 181 gagaagatca tcaagaacct catcaagaca gtcatcaagc tggccattct ttataggaat 241 aatcagttta atcaagatga gctagcattg atggagaaat ttaagaagaa agttcatcag 301 cttgctatga ccgtggtcag tttccatcag gtggattata cctttgaccg gaatgtgtta 361 tccaggctgt taaatgaatg cagagagatg ctgcaccaaa tcattcagcg ccacctcact 421 gccaagtcac atggacgggt taataatgtg tttgatcatt tttcagattg tgaatttttg 481 gctgccttgt ataatccttt tgggaatttt aaaccccact tacaaaaact atgtgatggt 541 atcaacaaaa tgttggatga agagaacatt taa //