LOCUS CR457135 609 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834G127D for gene PTTG1, pituitary tumor-transforming 1; complete cds, incl. stopcodon. ACCESSION CR457135 VERSION CR457135.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 609) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 609) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834G127D, ORFNo 1907 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834G127D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_004219 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..609 /db_xref="H-InvDB:HIT000267985" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834G127D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..609 /codon_start=1 /gene="PTTG1" /db_xref="GOA:Q6IAL9" /db_xref="H-InvDB:HIT000267985.12" /db_xref="InterPro:IPR006940" /db_xref="UniProtKB/TrEMBL:Q6IAL9" /protein_id="CAG33416.1" /translation="MATLIYVDKENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTP RFGKTFDAPPALPKATRKALGTVNRATEKSVKTKGPLKQKQPSFSAKKMTEKTVKAKS SVPASDDAYPEIEKFFPFNPLDFESFDLPEEHQIAHLPLSGVPLMILDEERELEKLFQ LGPPSPVKMPSPPWESNLLQSPSSILSTLDVELPPVCCDIDI" BASE COUNT 171 a 149 c 136 g 153 t ORIGIN 1 atggctactc tgatctatgt tgataaggaa aatggagaac caggcacccg tgtggttgct 61 aaggatgggc tgaagctggg gtctggacct tcaatcaaag ccttagatgg gagatctcaa 121 gtttcaacac cacgttttgg caaaacgttc gatgccccac cagccttacc taaagctact 181 agaaaggctt tgggaactgt caacagagct acagaaaagt ctgtaaagac caagggaccc 241 ctcaaacaaa aacagccaag cttttctgcc aaaaagatga ctgagaagac tgttaaagca 301 aaaagctctg ttcctgcctc agatgatgcc tatccagaaa tagaaaaatt ctttcccttc 361 aatcctctag actttgagag ttttgacctg cctgaagagc accagattgc gcacctcccc 421 ttgagtggag tgcctctcat gatccttgac gaggagagag agcttgaaaa gctgtttcag 481 ctgggccccc cttcacctgt gaagatgccc tctccaccat gggaatccaa tctgttgcag 541 tctccttcaa gcattctgtc gaccttggat gttgaattgc cacctgtttg ctgtgacata 601 gatatttaa //