LOCUS CR457116 1176 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834F1012D for gene HERPUD1, homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 1; complete cds, incl. stopcodon. ACCESSION CR457116 VERSION CR457116.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1176) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 1176) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834F1012D, ORFNo 1851 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834F1012D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_014685 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..1176 /db_xref="H-InvDB:HIT000267966" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834F1012D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..1176 /codon_start=1 /gene="HERPUD1" /db_xref="GOA:Q15011" /db_xref="H-InvDB:HIT000267966.12" /db_xref="HGNC:HGNC:13744" /db_xref="InterPro:IPR000626" /db_xref="InterPro:IPR029071" /db_xref="InterPro:IPR039751" /db_xref="PDB:1WGD" /db_xref="UniProtKB/Swiss-Prot:Q15011" /protein_id="CAG33397.1" /translation="MESETEPEPVTLLVKSPNQRHRDLELSGDRGWSVGHLKAHLSRV YPERPRPEDQRLIYSGKLLLDHQCLRDLLPKQEKRHVLHLVCNVKSPSKMPEINAKVA ESTEEPAGSNRGQYPEDSSSDGLRQREVLRNLSSPGWENISRPEAAQQAFQGLGPGFS GYTPYGWLQLSWFQQIYARQYYMQYLAATAASGAFVPPPSAQEIPVVSAPAPAPIHNQ FPAENQPANQNAAPQVVVNPGANQNLRMNAQGGPIVEEDDEINRDWLDWTYSAATFSV FLSILYFYSSLSRFLMVMGATVVMYLHHVGWFPFRPRPVQNFPNDGPPPDVVNQDPNN NLQEGTDPETEDPNHLPPDRDVLDGEQTSPSFMSTAWLVFKTFFASLLPEGPPAIAN" BASE COUNT 284 a 326 c 283 g 283 t ORIGIN 1 atggagtccg agaccgaacc cgagcccgtc acgctcctgg tgaagagccc caaccagcgc 61 caccgcgact tggagctgag tggcgaccgc ggctggagtg tgggccacct caaggcccac 121 ctgagccgcg tctaccccga gcgtccgcgt ccagaggacc agaggttaat ttattctggg 181 aagctgttgt tggatcacca atgtctcagg gacttgcttc caaagcagga aaaacggcat 241 gttttgcatc tggtgtgcaa tgtgaagagt ccttcaaaaa tgccagaaat caacgccaag 301 gtggctgaat ccacagagga gcctgctggt tctaatcggg gacagtatcc tgaggattcc 361 tcaagtgatg gtttaaggca aagggaagtt cttcggaacc tttcttcccc tggatgggaa 421 aacatctcaa ggcctgaagc tgcccagcag gcattccaag gcctgggtcc tggtttctcc 481 ggttacacac cctatgggtg gcttcagctt tcctggttcc agcagatata tgcacgacag 541 tactacatgc aatatttagc agccactgct gcatcagggg cttttgttcc accaccaagt 601 gcacaagaga tacctgtggt ctctgcacct gctccagccc ctattcacaa ccagtttcca 661 gctgaaaacc agcctgccaa tcagaatgct gctcctcaag tggttgttaa tcctggagcc 721 aatcaaaatt tgcggatgaa tgcacaaggt ggccctattg tggaagaaga tgatgaaata 781 aatcgagatt ggttggattg gacctattca gcagctacat tttctgtttt tctcagtatc 841 ctctacttct actcctccct gagcagattc ctcatggtca tgggggccac cgttgttatg 901 tacctgcatc acgttgggtg gtttccattt agaccgaggc cggttcagaa cttcccaaat 961 gatggtcctc ctcctgacgt tgtaaatcag gaccccaaca ataacttaca ggaaggcact 1021 gatcctgaaa ctgaagaccc caaccacctc cctccagaca gggatgtact agatggcgag 1081 cagaccagcc cctcctttat gagcacagca tggcttgtct tcaagacttt ctttgcctct 1141 cttcttccag aaggcccccc agccatcgca aattaa //