LOCUS       CR457116                1176 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834F1012D for
            gene HERPUD1, homocysteine-inducible, endoplasmic reticulum
            stress-inducible, ubiquitin-like domain member 1; complete cds,
            incl. stopcodon.
ACCESSION   CR457116
VERSION     CR457116.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1176)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 1176)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834F1012D, ORFNo 1851
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834F1012D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence NM_014685 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..1176
                     /db_xref="H-InvDB:HIT000267966"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834F1012D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..1176
                     /codon_start=1
                     /gene="HERPUD1"
                     /db_xref="GOA:Q15011"
                     /db_xref="H-InvDB:HIT000267966.12"
                     /db_xref="HGNC:HGNC:13744"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="InterPro:IPR039751"
                     /db_xref="PDB:1WGD"
                     /db_xref="UniProtKB/Swiss-Prot:Q15011"
                     /protein_id="CAG33397.1"
                     /translation="MESETEPEPVTLLVKSPNQRHRDLELSGDRGWSVGHLKAHLSRV
                     YPERPRPEDQRLIYSGKLLLDHQCLRDLLPKQEKRHVLHLVCNVKSPSKMPEINAKVA
                     ESTEEPAGSNRGQYPEDSSSDGLRQREVLRNLSSPGWENISRPEAAQQAFQGLGPGFS
                     GYTPYGWLQLSWFQQIYARQYYMQYLAATAASGAFVPPPSAQEIPVVSAPAPAPIHNQ
                     FPAENQPANQNAAPQVVVNPGANQNLRMNAQGGPIVEEDDEINRDWLDWTYSAATFSV
                     FLSILYFYSSLSRFLMVMGATVVMYLHHVGWFPFRPRPVQNFPNDGPPPDVVNQDPNN
                     NLQEGTDPETEDPNHLPPDRDVLDGEQTSPSFMSTAWLVFKTFFASLLPEGPPAIAN"
BASE COUNT          284 a          326 c          283 g          283 t
ORIGIN      
        1 atggagtccg agaccgaacc cgagcccgtc acgctcctgg tgaagagccc caaccagcgc
       61 caccgcgact tggagctgag tggcgaccgc ggctggagtg tgggccacct caaggcccac
      121 ctgagccgcg tctaccccga gcgtccgcgt ccagaggacc agaggttaat ttattctggg
      181 aagctgttgt tggatcacca atgtctcagg gacttgcttc caaagcagga aaaacggcat
      241 gttttgcatc tggtgtgcaa tgtgaagagt ccttcaaaaa tgccagaaat caacgccaag
      301 gtggctgaat ccacagagga gcctgctggt tctaatcggg gacagtatcc tgaggattcc
      361 tcaagtgatg gtttaaggca aagggaagtt cttcggaacc tttcttcccc tggatgggaa
      421 aacatctcaa ggcctgaagc tgcccagcag gcattccaag gcctgggtcc tggtttctcc
      481 ggttacacac cctatgggtg gcttcagctt tcctggttcc agcagatata tgcacgacag
      541 tactacatgc aatatttagc agccactgct gcatcagggg cttttgttcc accaccaagt
      601 gcacaagaga tacctgtggt ctctgcacct gctccagccc ctattcacaa ccagtttcca
      661 gctgaaaacc agcctgccaa tcagaatgct gctcctcaag tggttgttaa tcctggagcc
      721 aatcaaaatt tgcggatgaa tgcacaaggt ggccctattg tggaagaaga tgatgaaata
      781 aatcgagatt ggttggattg gacctattca gcagctacat tttctgtttt tctcagtatc
      841 ctctacttct actcctccct gagcagattc ctcatggtca tgggggccac cgttgttatg
      901 tacctgcatc acgttgggtg gtttccattt agaccgaggc cggttcagaa cttcccaaat
      961 gatggtcctc ctcctgacgt tgtaaatcag gaccccaaca ataacttaca ggaaggcact
     1021 gatcctgaaa ctgaagaccc caaccacctc cctccagaca gggatgtact agatggcgag
     1081 cagaccagcc cctcctttat gagcacagca tggcttgtct tcaagacttt ctttgcctct
     1141 cttcttccag aaggcccccc agccatcgca aattaa
//