LOCUS CR457109 381 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834E087D for gene ZNRD1, zinc ribbon domain containing, 1; complete cds, incl. stopcodon. ACCESSION CR457109 VERSION CR457109.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 381) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 381) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834E087D, ORFNo 1837 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E087D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_170783 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..381 /db_xref="H-InvDB:HIT000267959_09" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834E087D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..381 /codon_start=1 /gene="ZNRD1" /db_xref="GOA:Q9P1U0" /db_xref="H-InvDB:HIT000267959_03.4" /db_xref="HGNC:HGNC:13182" /db_xref="InterPro:IPR001222" /db_xref="InterPro:IPR012164" /db_xref="InterPro:IPR019761" /db_xref="InterPro:IPR034004" /db_xref="UniProtKB/Swiss-Prot:Q9P1U0" /protein_id="CAG33390.1" /translation="MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFN INVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQM RSADEGQTVFYTCTNCKFQEKEDS" BASE COUNT 81 a 97 c 111 g 92 t ORIGIN 1 atgtctgtca tggacctcgc caatacttgc tccagctttc agtcggacct ggatttctgt 61 tcagattgcg gctcggtcct gcctctgccc ggggctcagg atacggtcac ctgtattcgc 121 tgtggcttca acatcaacgt tcgggacttt gaggggaagg ttgtgaagac ttcggttgtg 181 ttccaccaac tggggacagc catgcctatg tcggtggagg aagggcctga gtgccaggga 241 cctgtggttg acaggcgctg ccctcgatgt ggtcatgaag gaatggcata ccacaccaga 301 cagatgcgtt cagccgatga agggcaaact gtcttctaca cctgtaccaa ctgcaagttc 361 caggagaagg aagactctta a //