LOCUS       CR457098                1005 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834B0419D for
            gene B3GAT1, beta-1,3-glucuronyltransferase 1
            (glucuronosyltransferase P); complete cds, incl. stopcodon.
ACCESSION   CR457098
VERSION     CR457098.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1005)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 1005)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834B0419D, ORFNo 1811
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834B0419D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence NM_054025 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..1005
                     /db_xref="H-InvDB:HIT000267948"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834B0419D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..1005
                     /codon_start=1
                     /gene="B3GAT1"
                     /db_xref="GOA:Q9P2W7"
                     /db_xref="H-InvDB:HIT000267948.12"
                     /db_xref="HGNC:HGNC:921"
                     /db_xref="InterPro:IPR005027"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="PDB:1V82"
                     /db_xref="PDB:1V83"
                     /db_xref="PDB:1V84"
                     /db_xref="UniProtKB/Swiss-Prot:Q9P2W7"
                     /protein_id="CAG33379.1"
                     /translation="MPKRRDILAIVLIVLPWTLLITVWHQSTLAPLLAVHKDEGSDPR
                     RETPPGADPREYCTSDRDIVEVVRTEYVYTRPPPWSDTLPTIHVVTPTYSRPVQKAEL
                     TRMANTLLHVPNLHWLVVEDAPRRTPLTARLLRDTGLNYTHLHVETPRNYKLRGDARD
                     PRIPRGTMQRNLALRWLRETFPRNSSQPGVVYFADDDNTYSLELFEEMRSTRRVSVWP
                     VAFVGGLRYEAPRVNGAGKVVGWKTVFDPHRPFAIDMAGFAVNLRLILQRSQAYFKLR
                     GVKGGYQESSLLRELVTLNDLEPKAANCTKILVWHTRTEKPVLVNEGKKGFTDPSVEI
                     "
BASE COUNT          199 a          346 c          310 g          150 t
ORIGIN      
        1 atgccgaaga gacgggacat cctagcgatc gtcctcatcg tgctgccctg gactctgctc
       61 atcactgtct ggcaccagag caccctcgca cccctgctcg cggtacataa ggatgagggc
      121 agtgaccccc gacgcgaaac gccgcccggc gccgacccca gggagtactg cacgtctgac
      181 cgcgacatcg tggaggtggt gcgcaccgag tacgtgtaca cgcggccccc gccatggtcc
      241 gacacgctgc ccaccatcca cgtggtgacg cccacctaca gccgcccggt gcagaaggcc
      301 gagctgacgc gcatggccaa cacgctgctg cacgtgccca acctccactg gctggtggtg
      361 gaggatgcgc cgcgccggac gccgctgacc gcgcgcctgc tgcgcgacac cggcctcaac
      421 tacacgcacc tgcacgtgga gacgccccgc aactacaagc tgcgcggaga cgcccgcgac
      481 ccacgcatcc cgcggggcac catgcagcgc aacctggccc tgcgctggct gcgcgagacc
      541 ttcccgcgca actccagcca gcctggcgtg gtctacttcg ccgacgacga caacacctac
      601 agcctggagc tcttcgaaga gatgcgcagc accaggaggg tgtccgtgtg gcccgtcgcc
      661 ttcgtgggtg gcctgcggta cgaggcccca cgggtgaacg gggcagggaa ggtggtcggc
      721 tggaagacgg tgtttgaccc ccaccggcca tttgcaatag acatggctgg atttgccgtc
      781 aacctgcggc tcattctgca gcgaagccag gcctacttca agctgcgagg tgtgaaggga
      841 ggctaccagg aaagcagcct ccttcgagaa cttgtcaccc tcaacgacct ggagcccaag
      901 gcagccaact gcaccaagat cctggtgtgg cacacacgga cagagaagcc agtgctggtg
      961 aatgagggca agaagggctt cactgacccc tcggtggaga tttaa
//