LOCUS CR457098 1005 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834B0419D for gene B3GAT1, beta-1,3-glucuronyltransferase 1 (glucuronosyltransferase P); complete cds, incl. stopcodon. ACCESSION CR457098 VERSION CR457098.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1005) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 1005) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834B0419D, ORFNo 1811 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834B0419D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_054025 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..1005 /db_xref="H-InvDB:HIT000267948" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834B0419D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..1005 /codon_start=1 /gene="B3GAT1" /db_xref="GOA:Q9P2W7" /db_xref="H-InvDB:HIT000267948.12" /db_xref="HGNC:HGNC:921" /db_xref="InterPro:IPR005027" /db_xref="InterPro:IPR029044" /db_xref="PDB:1V82" /db_xref="PDB:1V83" /db_xref="PDB:1V84" /db_xref="UniProtKB/Swiss-Prot:Q9P2W7" /protein_id="CAG33379.1" /translation="MPKRRDILAIVLIVLPWTLLITVWHQSTLAPLLAVHKDEGSDPR RETPPGADPREYCTSDRDIVEVVRTEYVYTRPPPWSDTLPTIHVVTPTYSRPVQKAEL TRMANTLLHVPNLHWLVVEDAPRRTPLTARLLRDTGLNYTHLHVETPRNYKLRGDARD PRIPRGTMQRNLALRWLRETFPRNSSQPGVVYFADDDNTYSLELFEEMRSTRRVSVWP VAFVGGLRYEAPRVNGAGKVVGWKTVFDPHRPFAIDMAGFAVNLRLILQRSQAYFKLR GVKGGYQESSLLRELVTLNDLEPKAANCTKILVWHTRTEKPVLVNEGKKGFTDPSVEI " BASE COUNT 199 a 346 c 310 g 150 t ORIGIN 1 atgccgaaga gacgggacat cctagcgatc gtcctcatcg tgctgccctg gactctgctc 61 atcactgtct ggcaccagag caccctcgca cccctgctcg cggtacataa ggatgagggc 121 agtgaccccc gacgcgaaac gccgcccggc gccgacccca gggagtactg cacgtctgac 181 cgcgacatcg tggaggtggt gcgcaccgag tacgtgtaca cgcggccccc gccatggtcc 241 gacacgctgc ccaccatcca cgtggtgacg cccacctaca gccgcccggt gcagaaggcc 301 gagctgacgc gcatggccaa cacgctgctg cacgtgccca acctccactg gctggtggtg 361 gaggatgcgc cgcgccggac gccgctgacc gcgcgcctgc tgcgcgacac cggcctcaac 421 tacacgcacc tgcacgtgga gacgccccgc aactacaagc tgcgcggaga cgcccgcgac 481 ccacgcatcc cgcggggcac catgcagcgc aacctggccc tgcgctggct gcgcgagacc 541 ttcccgcgca actccagcca gcctggcgtg gtctacttcg ccgacgacga caacacctac 601 agcctggagc tcttcgaaga gatgcgcagc accaggaggg tgtccgtgtg gcccgtcgcc 661 ttcgtgggtg gcctgcggta cgaggcccca cgggtgaacg gggcagggaa ggtggtcggc 721 tggaagacgg tgtttgaccc ccaccggcca tttgcaatag acatggctgg atttgccgtc 781 aacctgcggc tcattctgca gcgaagccag gcctacttca agctgcgagg tgtgaaggga 841 ggctaccagg aaagcagcct ccttcgagaa cttgtcaccc tcaacgacct ggagcccaag 901 gcagccaact gcaccaagat cctggtgtgg cacacacgga cagagaagcc agtgctggtg 961 aatgagggca agaagggctt cactgacccc tcggtggaga tttaa //