LOCUS       CR457081                1413 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834F0711D for
            gene SNX17, sorting nexin 17; complete cds, incl. stopcodon.
ACCESSION   CR457081
VERSION     CR457081.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1413)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 1413)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834F0711D, ORFNo 1767
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834F0711D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence BT007167 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..1413
                     /db_xref="H-InvDB:HIT000267931"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834F0711D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..1413
                     /codon_start=1
                     /gene="SNX17"
                     /db_xref="GOA:Q15036"
                     /db_xref="H-InvDB:HIT000267931.13"
                     /db_xref="HGNC:HGNC:14979"
                     /db_xref="InterPro:IPR000159"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR028666"
                     /db_xref="InterPro:IPR036871"
                     /db_xref="InterPro:IPR037831"
                     /db_xref="InterPro:IPR037836"
                     /db_xref="InterPro:IPR040842"
                     /db_xref="PDB:3FOG"
                     /db_xref="PDB:3LUI"
                     /db_xref="PDB:4GXB"
                     /db_xref="PDB:4TKN"
                     /db_xref="UniProtKB/Swiss-Prot:Q15036"
                     /protein_id="CAG33362.1"
                     /translation="MHFSIPETESRSGDSGGSAYVAYNIHVNGVLHCRVRYSQLLGLH
                     EQLRKEYGANVLPAFPPKKLFSLTPAEVEQRREQLEKYMQAVRQDPLLGSSETFNSFL
                     RRAQQETQQVPTEEVSLEVLLSNGQKVLVNVLTSDQTEDVLEAVAAKLDLPDDLIGYF
                     SLFLVREKEDGAFSFVRKLQEFELPYVSVTSLRSQEYKIVLRKSYWDSAYDDDVMENR
                     VGLNLLYAQTVSDIERGWILVTKEQHRQLKSLQEKVSKKEFLRLAQTLRHYGYLRFDA
                     CVADFPEKDCPVVVSAGNSELSLQLRLPGQQLREGSFRVTRMRCWRVTSSVPLPSGST
                     SSPGRGRGEVRLELAFEYLMSKDRLQWVTITSPQAIMMSICLQSMVDELMVKKSGGSI
                     RKMLRRRVGGTLRRSDSQQAVKSPPLLESPDATRESMVKLSSKLSAVSLRGIGSPSTD
                     ASASDVHGNFAFEGIGDEDL"
BASE COUNT          323 a          358 c          419 g          313 t
ORIGIN      
        1 atgcactttt ccattcccga aaccgagtcc cgcagcgggg acagcggcgg ctccgcctac
       61 gtggcctata acattcacgt gaatggagtc ctgcactgtc gggtgcgcta cagccagctc
      121 ctggggctgc acgagcagct tcggaaggag tatggggcca atgtgcttcc tgcattcccc
      181 ccaaagaagc ttttctctct gactcctgct gaggtagaac agaggagaga gcagttagag
      241 aagtacatgc aagctgttcg gcaagaccca ttgcttggga gcagcgagac tttcaacagt
      301 ttcctgcgtc gggcacaaca ggagacacag caggtcccca cagaggaagt gtccttggaa
      361 gtgctgctca gcaacgggca gaaagttctg gtcaacgtgc taacttcaga tcagactgag
      421 gatgtcctgg aggctgtagc tgcaaagctg gatcttccag atgacttgat tggatacttt
      481 agtctattct tagttcgaga aaaagaggat ggagcctttt cttttgtacg gaagttgcaa
      541 gagtttgagc tgccttatgt gtctgtcacc agccttcgga gtcaagagta taagattgtg
      601 ctaaggaaga gttattggga ctctgcctat gatgacgatg tcatggagaa ccgggttggc
      661 ctgaacctgc tttatgctca gacggtatca gatattgagc gtgggtggat cttggtcacc
      721 aaggaacagc accggcaact caaatctctg caagagaaag tctccaagaa ggagttcctg
      781 agactggccc agacgctgcg gcactatggc tacttgcgct ttgatgcctg tgtggctgac
      841 ttcccagaaa aggactgtcc tgtggtggtg agcgcgggca acagtgagct cagcctgcag
      901 ctccgcctgc ctggccagca actccgagaa ggctccttcc gggtcacccg catgcgatgc
      961 tggcgggtca cctcctctgt accattgccc agtggaagca cgagcagccc aggccggggc
     1021 cggggtgagg tgcgcctgga actggctttt gaatacctca tgagcaagga ccggctacag
     1081 tgggtcacca tcactagccc ccaggctatc atgatgagca tctgcttgca gtccatggtt
     1141 gatgaactga tggtgaagaa atctggcggc agtatcagga agatgctgcg ccggcgggtg
     1201 gggggtactc tgagacgctc agacagccag caagcagtga agtccccacc actgcttgag
     1261 tcacctgatg ccacccggga gtctatggtc aaactctcaa gtaagctgag tgccgtgagc
     1321 ttgcggggaa ttggcagtcc cagcacagat gccagtgcca gtgatgtcca cggcaatttc
     1381 gccttcgagg gcattggaga tgaggatctt taa
//