LOCUS CR457081 1413 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834F0711D for gene SNX17, sorting nexin 17; complete cds, incl. stopcodon. ACCESSION CR457081 VERSION CR457081.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1413) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 1413) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834F0711D, ORFNo 1767 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834F0711D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence BT007167 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..1413 /db_xref="H-InvDB:HIT000267931" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834F0711D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..1413 /codon_start=1 /gene="SNX17" /db_xref="GOA:Q15036" /db_xref="H-InvDB:HIT000267931.13" /db_xref="HGNC:HGNC:14979" /db_xref="InterPro:IPR000159" /db_xref="InterPro:IPR001683" /db_xref="InterPro:IPR011993" /db_xref="InterPro:IPR028666" /db_xref="InterPro:IPR036871" /db_xref="InterPro:IPR037831" /db_xref="InterPro:IPR037836" /db_xref="InterPro:IPR040842" /db_xref="PDB:3FOG" /db_xref="PDB:3LUI" /db_xref="PDB:4GXB" /db_xref="PDB:4TKN" /db_xref="UniProtKB/Swiss-Prot:Q15036" /protein_id="CAG33362.1" /translation="MHFSIPETESRSGDSGGSAYVAYNIHVNGVLHCRVRYSQLLGLH EQLRKEYGANVLPAFPPKKLFSLTPAEVEQRREQLEKYMQAVRQDPLLGSSETFNSFL RRAQQETQQVPTEEVSLEVLLSNGQKVLVNVLTSDQTEDVLEAVAAKLDLPDDLIGYF SLFLVREKEDGAFSFVRKLQEFELPYVSVTSLRSQEYKIVLRKSYWDSAYDDDVMENR VGLNLLYAQTVSDIERGWILVTKEQHRQLKSLQEKVSKKEFLRLAQTLRHYGYLRFDA CVADFPEKDCPVVVSAGNSELSLQLRLPGQQLREGSFRVTRMRCWRVTSSVPLPSGST SSPGRGRGEVRLELAFEYLMSKDRLQWVTITSPQAIMMSICLQSMVDELMVKKSGGSI RKMLRRRVGGTLRRSDSQQAVKSPPLLESPDATRESMVKLSSKLSAVSLRGIGSPSTD ASASDVHGNFAFEGIGDEDL" BASE COUNT 323 a 358 c 419 g 313 t ORIGIN 1 atgcactttt ccattcccga aaccgagtcc cgcagcgggg acagcggcgg ctccgcctac 61 gtggcctata acattcacgt gaatggagtc ctgcactgtc gggtgcgcta cagccagctc 121 ctggggctgc acgagcagct tcggaaggag tatggggcca atgtgcttcc tgcattcccc 181 ccaaagaagc ttttctctct gactcctgct gaggtagaac agaggagaga gcagttagag 241 aagtacatgc aagctgttcg gcaagaccca ttgcttggga gcagcgagac tttcaacagt 301 ttcctgcgtc gggcacaaca ggagacacag caggtcccca cagaggaagt gtccttggaa 361 gtgctgctca gcaacgggca gaaagttctg gtcaacgtgc taacttcaga tcagactgag 421 gatgtcctgg aggctgtagc tgcaaagctg gatcttccag atgacttgat tggatacttt 481 agtctattct tagttcgaga aaaagaggat ggagcctttt cttttgtacg gaagttgcaa 541 gagtttgagc tgccttatgt gtctgtcacc agccttcgga gtcaagagta taagattgtg 601 ctaaggaaga gttattggga ctctgcctat gatgacgatg tcatggagaa ccgggttggc 661 ctgaacctgc tttatgctca gacggtatca gatattgagc gtgggtggat cttggtcacc 721 aaggaacagc accggcaact caaatctctg caagagaaag tctccaagaa ggagttcctg 781 agactggccc agacgctgcg gcactatggc tacttgcgct ttgatgcctg tgtggctgac 841 ttcccagaaa aggactgtcc tgtggtggtg agcgcgggca acagtgagct cagcctgcag 901 ctccgcctgc ctggccagca actccgagaa ggctccttcc gggtcacccg catgcgatgc 961 tggcgggtca cctcctctgt accattgccc agtggaagca cgagcagccc aggccggggc 1021 cggggtgagg tgcgcctgga actggctttt gaatacctca tgagcaagga ccggctacag 1081 tgggtcacca tcactagccc ccaggctatc atgatgagca tctgcttgca gtccatggtt 1141 gatgaactga tggtgaagaa atctggcggc agtatcagga agatgctgcg ccggcgggtg 1201 gggggtactc tgagacgctc agacagccag caagcagtga agtccccacc actgcttgag 1261 tcacctgatg ccacccggga gtctatggtc aaactctcaa gtaagctgag tgccgtgagc 1321 ttgcggggaa ttggcagtcc cagcacagat gccagtgcca gtgatgtcca cggcaatttc 1381 gccttcgagg gcattggaga tgaggatctt taa //