LOCUS CR457077 1050 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834F0611D for gene IRF2, interferon regulatory factor 2; complete cds, incl. stopcodon. ACCESSION CR457077 VERSION CR457077.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1050) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 1050) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834F0611D, ORFNo 1757 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834F0611D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence BC015803 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..1050 /db_xref="H-InvDB:HIT000267927" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834F0611D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..1050 /codon_start=1 /gene="IRF2" /db_xref="GOA:P14316" /db_xref="H-InvDB:HIT000267927.12" /db_xref="HGNC:HGNC:6117" /db_xref="InterPro:IPR001346" /db_xref="InterPro:IPR017431" /db_xref="InterPro:IPR019817" /db_xref="InterPro:IPR031218" /db_xref="InterPro:IPR036388" /db_xref="InterPro:IPR036390" /db_xref="UniProtKB/Swiss-Prot:P14316" /protein_id="CAG33358.1" /translation="MPVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARH GWDVEKDAPLFRNWAIHTGKHQPGVDKPDPKTWKANFRCAMNSLPDIEEVKDKSIKKG NNAFRVYRMLPLSERPSKKGKKPKTEKEDKVKHIKQEPVESSLGLSNGVSDLSPEYAV LTSTIKNEVDSTVNIIVVGQSHLDSNIENQEIVTNPPDICQVVEVTTESDEQPVSMSE LYPLQISPVSSYAESETTDSVPSDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPG MASFVTSNKPDLQVTIKEESNPVPYNSSWPPFQDLPLSSSMTPASSSSRPDRETRASV IKKTSDITQARVKSC" BASE COUNT 321 a 267 c 264 g 198 t ORIGIN 1 atgccggtgg aaaggatgcg catgcgcccg tggctggagg agcagataaa ctccaacacg 61 atcccggggc tcaagtggct taacaaggaa aagaagattt ttcagatccc ctggatgcat 121 gcggctagac atgggtggga tgtggaaaaa gatgcaccac tctttagaaa ctgggcaatc 181 catacaggaa agcatcaacc aggagtagat aaacctgatc ccaaaacatg gaaggcgaat 241 ttcagatgcg ccatgaattc cttgcctgat attgaagaag tcaaggataa aagcataaag 301 aaaggaaata atgccttcag ggtctaccga atgctgcccc tatcagaacg gccttctaag 361 aaaggaaaga aaccaaagac agaaaaagaa gacaaagtta agcacatcaa gcaagaacca 421 gttgagtcat ctctggggct tagtaatgga gtaagtgatc tttctcctga gtatgcggtc 481 ctgacttcaa ctataaaaaa tgaagtggat agtacggtga acatcatagt tgtaggacag 541 tcccatctgg acagcaacat tgagaatcaa gagattgtca ccaatccgcc agacatttgc 601 caagttgtag aggtgaccac tgagagcgac gagcagccgg tcagcatgag cgagctctac 661 cctctgcaga tctcccccgt gtcttcctat gcagaaagcg aaacgactga tagtgtgccc 721 agcgatgaag agagtgccga gggacggcca cactggcgga agaggaatat tgaaggcaaa 781 cagtacctca gcaacatggg gactcgaggc tcctacctgc tgcccggcat ggcgtccttc 841 gtcacttcca acaaaccgga cctccaggtc accatcaaag aggagagcaa tccggtgcct 901 tacaacagct cctggccccc ttttcaagac ctcccccttt cttcctccat gaccccagca 961 tccagcagca gtcggccaga ccgggagacc cgggccagcg tcatcaagaa aacatcggat 1021 atcacccagg cccgcgtcaa gagctgttaa //