LOCUS       CR457077                1050 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834F0611D for
            gene IRF2, interferon regulatory factor 2; complete cds, incl.
            stopcodon.
ACCESSION   CR457077
VERSION     CR457077.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1050)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 1050)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834F0611D, ORFNo 1757
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834F0611D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence BC015803 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..1050
                     /db_xref="H-InvDB:HIT000267927"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834F0611D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..1050
                     /codon_start=1
                     /gene="IRF2"
                     /db_xref="GOA:P14316"
                     /db_xref="H-InvDB:HIT000267927.12"
                     /db_xref="HGNC:HGNC:6117"
                     /db_xref="InterPro:IPR001346"
                     /db_xref="InterPro:IPR017431"
                     /db_xref="InterPro:IPR019817"
                     /db_xref="InterPro:IPR031218"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="UniProtKB/Swiss-Prot:P14316"
                     /protein_id="CAG33358.1"
                     /translation="MPVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARH
                     GWDVEKDAPLFRNWAIHTGKHQPGVDKPDPKTWKANFRCAMNSLPDIEEVKDKSIKKG
                     NNAFRVYRMLPLSERPSKKGKKPKTEKEDKVKHIKQEPVESSLGLSNGVSDLSPEYAV
                     LTSTIKNEVDSTVNIIVVGQSHLDSNIENQEIVTNPPDICQVVEVTTESDEQPVSMSE
                     LYPLQISPVSSYAESETTDSVPSDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPG
                     MASFVTSNKPDLQVTIKEESNPVPYNSSWPPFQDLPLSSSMTPASSSSRPDRETRASV
                     IKKTSDITQARVKSC"
BASE COUNT          321 a          267 c          264 g          198 t
ORIGIN      
        1 atgccggtgg aaaggatgcg catgcgcccg tggctggagg agcagataaa ctccaacacg
       61 atcccggggc tcaagtggct taacaaggaa aagaagattt ttcagatccc ctggatgcat
      121 gcggctagac atgggtggga tgtggaaaaa gatgcaccac tctttagaaa ctgggcaatc
      181 catacaggaa agcatcaacc aggagtagat aaacctgatc ccaaaacatg gaaggcgaat
      241 ttcagatgcg ccatgaattc cttgcctgat attgaagaag tcaaggataa aagcataaag
      301 aaaggaaata atgccttcag ggtctaccga atgctgcccc tatcagaacg gccttctaag
      361 aaaggaaaga aaccaaagac agaaaaagaa gacaaagtta agcacatcaa gcaagaacca
      421 gttgagtcat ctctggggct tagtaatgga gtaagtgatc tttctcctga gtatgcggtc
      481 ctgacttcaa ctataaaaaa tgaagtggat agtacggtga acatcatagt tgtaggacag
      541 tcccatctgg acagcaacat tgagaatcaa gagattgtca ccaatccgcc agacatttgc
      601 caagttgtag aggtgaccac tgagagcgac gagcagccgg tcagcatgag cgagctctac
      661 cctctgcaga tctcccccgt gtcttcctat gcagaaagcg aaacgactga tagtgtgccc
      721 agcgatgaag agagtgccga gggacggcca cactggcgga agaggaatat tgaaggcaaa
      781 cagtacctca gcaacatggg gactcgaggc tcctacctgc tgcccggcat ggcgtccttc
      841 gtcacttcca acaaaccgga cctccaggtc accatcaaag aggagagcaa tccggtgcct
      901 tacaacagct cctggccccc ttttcaagac ctcccccttt cttcctccat gaccccagca
      961 tccagcagca gtcggccaga ccgggagacc cgggccagcg tcatcaagaa aacatcggat
     1021 atcacccagg cccgcgtcaa gagctgttaa
//