LOCUS CR457067 1005 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834H0411D for gene HSF2BP, heat shock transcription factor 2 binding protein; complete cds, incl. stopcodon. ACCESSION CR457067 VERSION CR457067.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1005) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 1005) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834H0411D, ORFNo 1731 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H0411D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_007031 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..1005 /db_xref="H-InvDB:HIT000267917" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834H0411D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..1005 /codon_start=1 /gene="HSF2BP" /db_xref="H-InvDB:HIT000267917.11" /db_xref="InterPro:IPR011989" /db_xref="InterPro:IPR016024" /db_xref="InterPro:IPR039584" /db_xref="UniProtKB/TrEMBL:Q6IAT7" /protein_id="CAG33348.1" /translation="MGEAGAAEEACRHMGTKEEFVKVRKKDLERLTTEVMQIRDFLPR ILNGEVLESFQKLKIVEKNLERKEQELEQLKMDCEHFKARLETVQADNIREKKEKLAL RQQLNEAKQQLLQQAEYCTEMGAAACTLLWGVSSSEEVVKAILGGDKALKFFSITGQT MESFVKSLDGDVQELDSDESQFVFALAGIVTNVAAIACGREFLVNSSRVLLDTILQLL GDLKPGQCTKLKVLMLMSLYNVSINLKGLKYISESPGFIPLLWWLLSDPDAEVCLHVL RLVQSVVLEPEVFSKSASEFRSSLPLQRILAMSKSRNPRLQTAAQELLEDLRTLEHNV " BASE COUNT 277 a 213 c 283 g 232 t ORIGIN 1 atgggcgaag cgggcgccgc tgaggaggcc tgccggcaca tgggaactaa agaggaattt 61 gttaaagtca gaaagaagga tctggaacgg ctgacaaccg aagtgatgca aatacgggac 121 ttcttaccca gaatactaaa tggggaggtg ctggagagct tccagaaatt aaagattgta 181 gaaaaaaacc tggaaaggaa agagcaagaa ttagagcagc tgaaaatgga ttgtgagcac 241 tttaaagccc gcctggaaac cgtgcaggcc gacaacataa gagagaagaa ggagaaactg 301 gctcttcgac agcagttgaa tgaagcgaag cagcaactcc tgcagcaggc agagtattgt 361 acagaaatgg gagcagcagc gtgtaccctc ttgtggggtg tctccagcag tgaggaagtc 421 gtcaaggcca ttttgggagg agataaagct ttgaagtttt tcagcatcac tggtcaaaca 481 atggagagtt ttgtgaagtc gttagacggt gatgtccagg agctggattc ggatgaaagt 541 cagtttgttt tcgctctggc tggaattgtc acgaatgttg ctgctatagc atgtggtcgt 601 gaattcttgg ttaattcaag ccgggtgctc ttggacacca tattgcagct tctgggagac 661 ttgaagccag gacagtgtac caaactcaaa gtgctaatgc tgatgtccct atacaatgta 721 agcatcaatt tgaaaggctt gaaatacatc agcgagagtc caggattcat ccctttgctg 781 tggtggcttt tgagtgatcc agatgcagag gtgtgccttc atgtactgag gcttgtccag 841 tctgtggttc tggaacctga agtcttctcc aagtcggcct ctgagttccg gagctccctg 901 cccctgcaac gcatcctggc aatgtccaag agccgcaacc cccgcctgca aaccgcagcc 961 caggagctcc tggaagatct ccgcactctg gagcataatg tttaa //