LOCUS       CR457067                1005 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834H0411D for
            gene HSF2BP, heat shock transcription factor 2 binding protein;
            complete cds, incl. stopcodon.
ACCESSION   CR457067
VERSION     CR457067.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1005)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 1005)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834H0411D, ORFNo 1731
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H0411D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence NM_007031 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..1005
                     /db_xref="H-InvDB:HIT000267917"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834H0411D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..1005
                     /codon_start=1
                     /gene="HSF2BP"
                     /db_xref="H-InvDB:HIT000267917.11"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR039584"
                     /db_xref="UniProtKB/TrEMBL:Q6IAT7"
                     /protein_id="CAG33348.1"
                     /translation="MGEAGAAEEACRHMGTKEEFVKVRKKDLERLTTEVMQIRDFLPR
                     ILNGEVLESFQKLKIVEKNLERKEQELEQLKMDCEHFKARLETVQADNIREKKEKLAL
                     RQQLNEAKQQLLQQAEYCTEMGAAACTLLWGVSSSEEVVKAILGGDKALKFFSITGQT
                     MESFVKSLDGDVQELDSDESQFVFALAGIVTNVAAIACGREFLVNSSRVLLDTILQLL
                     GDLKPGQCTKLKVLMLMSLYNVSINLKGLKYISESPGFIPLLWWLLSDPDAEVCLHVL
                     RLVQSVVLEPEVFSKSASEFRSSLPLQRILAMSKSRNPRLQTAAQELLEDLRTLEHNV
                     "
BASE COUNT          277 a          213 c          283 g          232 t
ORIGIN      
        1 atgggcgaag cgggcgccgc tgaggaggcc tgccggcaca tgggaactaa agaggaattt
       61 gttaaagtca gaaagaagga tctggaacgg ctgacaaccg aagtgatgca aatacgggac
      121 ttcttaccca gaatactaaa tggggaggtg ctggagagct tccagaaatt aaagattgta
      181 gaaaaaaacc tggaaaggaa agagcaagaa ttagagcagc tgaaaatgga ttgtgagcac
      241 tttaaagccc gcctggaaac cgtgcaggcc gacaacataa gagagaagaa ggagaaactg
      301 gctcttcgac agcagttgaa tgaagcgaag cagcaactcc tgcagcaggc agagtattgt
      361 acagaaatgg gagcagcagc gtgtaccctc ttgtggggtg tctccagcag tgaggaagtc
      421 gtcaaggcca ttttgggagg agataaagct ttgaagtttt tcagcatcac tggtcaaaca
      481 atggagagtt ttgtgaagtc gttagacggt gatgtccagg agctggattc ggatgaaagt
      541 cagtttgttt tcgctctggc tggaattgtc acgaatgttg ctgctatagc atgtggtcgt
      601 gaattcttgg ttaattcaag ccgggtgctc ttggacacca tattgcagct tctgggagac
      661 ttgaagccag gacagtgtac caaactcaaa gtgctaatgc tgatgtccct atacaatgta
      721 agcatcaatt tgaaaggctt gaaatacatc agcgagagtc caggattcat ccctttgctg
      781 tggtggcttt tgagtgatcc agatgcagag gtgtgccttc atgtactgag gcttgtccag
      841 tctgtggttc tggaacctga agtcttctcc aagtcggcct ctgagttccg gagctccctg
      901 cccctgcaac gcatcctggc aatgtccaag agccgcaacc cccgcctgca aaccgcagcc
      961 caggagctcc tggaagatct ccgcactctg gagcataatg tttaa
//