LOCUS CR457064 696 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834D097D for gene IL15RA, interleukin 15 receptor, alpha; complete cds, incl. stopcodon. ACCESSION CR457064 VERSION CR457064.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 696) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 696) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834D097D, ORFNo 1717 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834D097D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_172200 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..696 /db_xref="H-InvDB:HIT000267914" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834D097D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..696 /codon_start=1 /gene="IL15RA" /db_xref="GOA:Q13261" /db_xref="H-InvDB:HIT000267914.12" /db_xref="HGNC:HGNC:5978" /db_xref="InterPro:IPR000436" /db_xref="InterPro:IPR035976" /db_xref="InterPro:IPR042372" /db_xref="PDB:2ERS" /db_xref="PDB:2Z3Q" /db_xref="PDB:2Z3R" /db_xref="PDB:4GS7" /db_xref="UniProtKB/Swiss-Prot:Q13261" /protein_id="CAG33345.1" /translation="MSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKA TNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNN TAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGV YPQGHSDTTVAISTSTVLLCGLSAVSLLACYLKSRQTPPLASVEMEAMEALPVTWGTS SRDEDLENCSHHL" BASE COUNT 172 a 232 c 169 g 123 t ORIGIN 1 atgtccgtgg aacacgcaga catctgggtc aagagctaca gcttgtactc cagggagcgg 61 tacatttgta actctggttt caagcgtaaa gccggcacgt ccagcctgac ggagtgcgtg 121 ttgaacaagg ccacgaatgt cgcccactgg acaaccccca gtctcaaatg cattagagac 181 cctgccctgg ttcaccaaag gccagcgcca ccctccacag taacgacggc aggggtgacc 241 ccacagccag agagcctctc cccttctgga aaagagcccg cagcttcatc tcccagctca 301 aacaacacag cggccacaac agcagctatt gtcccgggct cccagctgat gccttcaaaa 361 tcaccttcca caggaaccac agagataagc agtcatgagt cctcccacgg caccccctct 421 cagacaacag ccaagaactg ggaactcaca gcatccgcct cccaccagcc gccaggtgtg 481 tatccacagg gccacagcga caccactgtg gctatctcca cgtccactgt cctgctgtgt 541 gggctgagcg ctgtgtctct cctggcatgc tacctcaagt caaggcaaac tcccccgctg 601 gccagcgttg aaatggaagc catggaggct ctgccggtga cttgggggac cagcagcaga 661 gatgaagact tggaaaactg ctctcaccac ctttaa //