LOCUS       CR457064                 696 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834D097D for
            gene IL15RA, interleukin 15 receptor, alpha; complete cds, incl.
            stopcodon.
ACCESSION   CR457064
VERSION     CR457064.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 696)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 696)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834D097D, ORFNo 1717
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834D097D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence NM_172200 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..696
                     /db_xref="H-InvDB:HIT000267914"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834D097D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..696
                     /codon_start=1
                     /gene="IL15RA"
                     /db_xref="GOA:Q13261"
                     /db_xref="H-InvDB:HIT000267914.12"
                     /db_xref="HGNC:HGNC:5978"
                     /db_xref="InterPro:IPR000436"
                     /db_xref="InterPro:IPR035976"
                     /db_xref="InterPro:IPR042372"
                     /db_xref="PDB:2ERS"
                     /db_xref="PDB:2Z3Q"
                     /db_xref="PDB:2Z3R"
                     /db_xref="PDB:4GS7"
                     /db_xref="UniProtKB/Swiss-Prot:Q13261"
                     /protein_id="CAG33345.1"
                     /translation="MSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKA
                     TNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNN
                     TAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGV
                     YPQGHSDTTVAISTSTVLLCGLSAVSLLACYLKSRQTPPLASVEMEAMEALPVTWGTS
                     SRDEDLENCSHHL"
BASE COUNT          172 a          232 c          169 g          123 t
ORIGIN      
        1 atgtccgtgg aacacgcaga catctgggtc aagagctaca gcttgtactc cagggagcgg
       61 tacatttgta actctggttt caagcgtaaa gccggcacgt ccagcctgac ggagtgcgtg
      121 ttgaacaagg ccacgaatgt cgcccactgg acaaccccca gtctcaaatg cattagagac
      181 cctgccctgg ttcaccaaag gccagcgcca ccctccacag taacgacggc aggggtgacc
      241 ccacagccag agagcctctc cccttctgga aaagagcccg cagcttcatc tcccagctca
      301 aacaacacag cggccacaac agcagctatt gtcccgggct cccagctgat gccttcaaaa
      361 tcaccttcca caggaaccac agagataagc agtcatgagt cctcccacgg caccccctct
      421 cagacaacag ccaagaactg ggaactcaca gcatccgcct cccaccagcc gccaggtgtg
      481 tatccacagg gccacagcga caccactgtg gctatctcca cgtccactgt cctgctgtgt
      541 gggctgagcg ctgtgtctct cctggcatgc tacctcaagt caaggcaaac tcccccgctg
      601 gccagcgttg aaatggaagc catggaggct ctgccggtga cttgggggac cagcagcaga
      661 gatgaagact tggaaaactg ctctcaccac ctttaa
//