LOCUS CR457052 231 bp mRNA linear HUM 03-JUN-2004 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834E027D for gene PKIA, protein kinase (cAMP-dependent, catalytic) inhibitor alpha; complete cds, incl. stopcodon. ACCESSION CR457052 VERSION CR457052.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 231) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 231) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834E027D, ORFNo 1659 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E027D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_006823 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..231 /db_xref="H-InvDB:HIT000267902" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834E027D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..231 /codon_start=1 /gene="PKIA" /db_xref="GOA:P61925" /db_xref="H-InvDB:HIT000267902.11" /db_xref="HGNC:HGNC:9017" /db_xref="InterPro:IPR004171" /db_xref="PDB:1CMK" /db_xref="PDB:1JLU" /db_xref="PDB:1Q8T" /db_xref="PDB:1VEB" /db_xref="PDB:1XH4" /db_xref="PDB:1XH5" /db_xref="PDB:1XH6" /db_xref="PDB:1XH7" /db_xref="PDB:1XH8" /db_xref="PDB:1XH9" /db_xref="PDB:1XHA" /db_xref="PDB:1YDR" /db_xref="PDB:2C1A" /db_xref="PDB:2C1B" /db_xref="PDB:2F7E" /db_xref="PDB:2GNI" /db_xref="PDB:2JDS" /db_xref="PDB:2JDT" /db_xref="PDB:2JDV" /db_xref="PDB:2L1L" /db_xref="PDB:2UVX" /db_xref="PDB:2UVY" /db_xref="PDB:2UVZ" /db_xref="PDB:2UW0" /db_xref="PDB:2UW3" /db_xref="PDB:2UW4" /db_xref="PDB:2UW5" /db_xref="PDB:2UW6" /db_xref="PDB:2UW7" /db_xref="PDB:2UW8" /db_xref="PDB:2VNW" /db_xref="PDB:2VNY" /db_xref="PDB:2VO0" /db_xref="PDB:2VO3" /db_xref="PDB:2VO6" /db_xref="PDB:2VO7" /db_xref="PDB:3AMA" /db_xref="PDB:3AMB" /db_xref="PDB:3L9L" /db_xref="PDB:3L9M" /db_xref="PDB:3L9N" /db_xref="PDB:3MVJ" /db_xref="PDB:3NX8" /db_xref="PDB:3OOG" /db_xref="PDB:3OVV" /db_xref="PDB:3OWP" /db_xref="PDB:3OXT" /db_xref="PDB:3P0M" /db_xref="PDB:3POO" /db_xref="PDB:3VQH" /db_xref="PDB:3WYG" /db_xref="PDB:3X2U" /db_xref="PDB:3X2V" /db_xref="PDB:3X2W" /db_xref="PDB:4AXA" /db_xref="PDB:4IAC" /db_xref="PDB:4IAD" /db_xref="PDB:4IAF" /db_xref="PDB:4IAI" /db_xref="PDB:4IAK" /db_xref="PDB:4IAY" /db_xref="PDB:4IAZ" /db_xref="PDB:4IB0" /db_xref="PDB:4IB1" /db_xref="PDB:4IB3" /db_xref="PDB:4IE9" /db_xref="PDB:4IJ9" /db_xref="PDB:4O21" /db_xref="PDB:4O22" /db_xref="PDB:4UJ1" /db_xref="PDB:4UJ2" /db_xref="PDB:4UJ9" /db_xref="PDB:4UJA" /db_xref="PDB:4UJB" /db_xref="PDB:4WB5" /db_xref="PDB:4WB6" /db_xref="PDB:4WB7" /db_xref="PDB:4WB8" /db_xref="PDB:4Z83" /db_xref="PDB:4Z84" /db_xref="PDB:5BX6" /db_xref="PDB:5BX7" /db_xref="PDB:5DH9" /db_xref="PDB:5LCP" /db_xref="PDB:5LCQ" /db_xref="PDB:5LCR" /db_xref="PDB:5LCT" /db_xref="PDB:5LCU" /db_xref="PDB:5M0B" /db_xref="PDB:5M0C" /db_xref="PDB:5M0L" /db_xref="PDB:5M0U" /db_xref="PDB:5M6V" /db_xref="PDB:5M6Y" /db_xref="PDB:5M71" /db_xref="PDB:5M75" /db_xref="PDB:5N23" /db_xref="PDB:5XOJ" /db_xref="PDB:6E21" /db_xref="PDB:6E99" /db_xref="PDB:6E9L" /db_xref="PDB:6FRX" /db_xref="UniProtKB/Swiss-Prot:P61925" /protein_id="CAG33333.1" /translation="MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAG LDINKTEGEEDAQRSSTEQSGEAQGEAAKSES" BASE COUNT 88 a 37 c 56 g 50 t ORIGIN 1 atgactgatg tggaaactac atatgcagat tttattgctt caggaagaac aggtagaaga 61 aatgcaatac atgatatcct ggtttcctct gcaagtggca acagcaatga attagccttg 121 aaattagcag gtcttgatat caacaagaca gaaggtgaag aagatgcaca acgaagttct 181 acagaacaaa gtggggaagc ccagggagaa gcagcaaaat ctgaaagtta a //