LOCUS       CR457052                 231 bp    mRNA    linear   HUM 03-JUN-2004
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834E027D for
            gene PKIA, protein kinase (cAMP-dependent, catalytic) inhibitor
            alpha; complete cds, incl. stopcodon.
ACCESSION   CR457052
VERSION     CR457052.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 231)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 231)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834E027D, ORFNo 1659
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E027D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence NM_006823 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..231
                     /db_xref="H-InvDB:HIT000267902"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834E027D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..231
                     /codon_start=1
                     /gene="PKIA"
                     /db_xref="GOA:P61925"
                     /db_xref="H-InvDB:HIT000267902.11"
                     /db_xref="HGNC:HGNC:9017"
                     /db_xref="InterPro:IPR004171"
                     /db_xref="PDB:1CMK"
                     /db_xref="PDB:1JLU"
                     /db_xref="PDB:1Q8T"
                     /db_xref="PDB:1VEB"
                     /db_xref="PDB:1XH4"
                     /db_xref="PDB:1XH5"
                     /db_xref="PDB:1XH6"
                     /db_xref="PDB:1XH7"
                     /db_xref="PDB:1XH8"
                     /db_xref="PDB:1XH9"
                     /db_xref="PDB:1XHA"
                     /db_xref="PDB:1YDR"
                     /db_xref="PDB:2C1A"
                     /db_xref="PDB:2C1B"
                     /db_xref="PDB:2F7E"
                     /db_xref="PDB:2GNI"
                     /db_xref="PDB:2JDS"
                     /db_xref="PDB:2JDT"
                     /db_xref="PDB:2JDV"
                     /db_xref="PDB:2L1L"
                     /db_xref="PDB:2UVX"
                     /db_xref="PDB:2UVY"
                     /db_xref="PDB:2UVZ"
                     /db_xref="PDB:2UW0"
                     /db_xref="PDB:2UW3"
                     /db_xref="PDB:2UW4"
                     /db_xref="PDB:2UW5"
                     /db_xref="PDB:2UW6"
                     /db_xref="PDB:2UW7"
                     /db_xref="PDB:2UW8"
                     /db_xref="PDB:2VNW"
                     /db_xref="PDB:2VNY"
                     /db_xref="PDB:2VO0"
                     /db_xref="PDB:2VO3"
                     /db_xref="PDB:2VO6"
                     /db_xref="PDB:2VO7"
                     /db_xref="PDB:3AMA"
                     /db_xref="PDB:3AMB"
                     /db_xref="PDB:3L9L"
                     /db_xref="PDB:3L9M"
                     /db_xref="PDB:3L9N"
                     /db_xref="PDB:3MVJ"
                     /db_xref="PDB:3NX8"
                     /db_xref="PDB:3OOG"
                     /db_xref="PDB:3OVV"
                     /db_xref="PDB:3OWP"
                     /db_xref="PDB:3OXT"
                     /db_xref="PDB:3P0M"
                     /db_xref="PDB:3POO"
                     /db_xref="PDB:3VQH"
                     /db_xref="PDB:3WYG"
                     /db_xref="PDB:3X2U"
                     /db_xref="PDB:3X2V"
                     /db_xref="PDB:3X2W"
                     /db_xref="PDB:4AXA"
                     /db_xref="PDB:4IAC"
                     /db_xref="PDB:4IAD"
                     /db_xref="PDB:4IAF"
                     /db_xref="PDB:4IAI"
                     /db_xref="PDB:4IAK"
                     /db_xref="PDB:4IAY"
                     /db_xref="PDB:4IAZ"
                     /db_xref="PDB:4IB0"
                     /db_xref="PDB:4IB1"
                     /db_xref="PDB:4IB3"
                     /db_xref="PDB:4IE9"
                     /db_xref="PDB:4IJ9"
                     /db_xref="PDB:4O21"
                     /db_xref="PDB:4O22"
                     /db_xref="PDB:4UJ1"
                     /db_xref="PDB:4UJ2"
                     /db_xref="PDB:4UJ9"
                     /db_xref="PDB:4UJA"
                     /db_xref="PDB:4UJB"
                     /db_xref="PDB:4WB5"
                     /db_xref="PDB:4WB6"
                     /db_xref="PDB:4WB7"
                     /db_xref="PDB:4WB8"
                     /db_xref="PDB:4Z83"
                     /db_xref="PDB:4Z84"
                     /db_xref="PDB:5BX6"
                     /db_xref="PDB:5BX7"
                     /db_xref="PDB:5DH9"
                     /db_xref="PDB:5LCP"
                     /db_xref="PDB:5LCQ"
                     /db_xref="PDB:5LCR"
                     /db_xref="PDB:5LCT"
                     /db_xref="PDB:5LCU"
                     /db_xref="PDB:5M0B"
                     /db_xref="PDB:5M0C"
                     /db_xref="PDB:5M0L"
                     /db_xref="PDB:5M0U"
                     /db_xref="PDB:5M6V"
                     /db_xref="PDB:5M6Y"
                     /db_xref="PDB:5M71"
                     /db_xref="PDB:5M75"
                     /db_xref="PDB:5N23"
                     /db_xref="PDB:5XOJ"
                     /db_xref="PDB:6E21"
                     /db_xref="PDB:6E99"
                     /db_xref="PDB:6E9L"
                     /db_xref="PDB:6FRX"
                     /db_xref="UniProtKB/Swiss-Prot:P61925"
                     /protein_id="CAG33333.1"
                     /translation="MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAG
                     LDINKTEGEEDAQRSSTEQSGEAQGEAAKSES"
BASE COUNT           88 a           37 c           56 g           50 t
ORIGIN      
        1 atgactgatg tggaaactac atatgcagat tttattgctt caggaagaac aggtagaaga
       61 aatgcaatac atgatatcct ggtttcctct gcaagtggca acagcaatga attagccttg
      121 aaattagcag gtcttgatat caacaagaca gaaggtgaag aagatgcaca acgaagttct
      181 acagaacaaa gtggggaagc ccagggagaa gcagcaaaat ctgaaagtta a
//