LOCUS       CR456999                 435 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834F035D for
            gene SURB7, SRB7 suppressor of RNA polymerase B homolog (yeast);
            complete cds, incl. stopcodon.
ACCESSION   CR456999
VERSION     CR456999.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 435)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 435)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834F035D, ORFNo 1529
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834F035D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence NM_004264 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..435
                     /db_xref="H-InvDB:HIT000267849"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834F035D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..435
                     /codon_start=1
                     /gene="SURB7"
                     /db_xref="GOA:Q13503"
                     /db_xref="H-InvDB:HIT000267849.12"
                     /db_xref="HGNC:HGNC:11473"
                     /db_xref="InterPro:IPR021384"
                     /db_xref="InterPro:IPR037212"
                     /db_xref="UniProtKB/Swiss-Prot:Q13503"
                     /protein_id="CAG33280.1"
                     /translation="MADRLTQLQDAVNSLADQFCNAIGVLQQCGPPASFNNIQTAINK
                     DQPANPTEEYAQLFAALIARTAKDIDVLIDSLPSEESTAALQAASLYKLEEENHEAAT
                     CLEDVVYRGDMLLEKIQSALADIAQSQLKTRSGTHSQSLPDS"
BASE COUNT          128 a           97 c           98 g          112 t
ORIGIN      
        1 atggcggatc ggctcacgca gcttcaggac gctgtgaatt cgcttgcaga tcagttttgt
       61 aatgccattg gagtattgca gcaatgtggt cctcctgcct ctttcaataa tattcagaca
      121 gcaattaaca aagaccagcc agctaaccct acagaagagt atgcccagct ttttgcagca
      181 ctgattgcac gaacagcaaa agacattgat gttttgatag attccttacc cagtgaagaa
      241 tctacagctg ctttacaggc tgctagcttg tataagctag aagaagaaaa ccatgaagct
      301 gctacatgtc tggaggatgt tgtttatcga ggagacatgc ttctggagaa gatacaaagc
      361 gcacttgctg atattgcaca gtcacagctg aagacaagaa gtggtaccca tagccagtct
      421 cttccagact cttaa
//