LOCUS CR456966 1011 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834B085D for gene C10orf7, chromosome 10 open reading frame 7; complete cds, incl. stopcodon. ACCESSION CR456966 VERSION CR456966.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1011) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 1011) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834B085D, ORFNo 1450 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834B085D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence BC001600 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..1011 /db_xref="H-InvDB:HIT000267816" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834B085D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..1011 /codon_start=1 /gene="C10orf7" /db_xref="GOA:O75794" /db_xref="H-InvDB:HIT000267816.12" /db_xref="HGNC:HGNC:16827" /db_xref="InterPro:IPR009772" /db_xref="UniProtKB/Swiss-Prot:O75794" /protein_id="CAG33247.1" /translation="MKKEHVLHCQFSAWYPFFRGVTIKSVILPLPQNVKDYLLDDGTL VVSGRDDPPTHSQPDSDDEAEEIQWSDDENTATLTAPEFPEFATKVQEAINSLGGSVF PKLNWSAPRDAYWIAMNSSLKCKTLSDIFLLFKSSDFITRDFTQPFIHCTDDSPDPCI EYELVLRKWCELIPGAEFRCFVKENKLIGISQRDYTQYYDHISKQKEEIRRCIQDFFK KHIQYKFLDEDFVFDIYRDSRGKVWLIDFNPFGEVTDSLLFTWEELISENNLNGDFSE VDAQEQDSPAFRCTNSEVTVQPSPYLSYRLPKDFVDLSTGEDAHKLIDFLKLKRNQQE DD" BASE COUNT 294 a 216 c 226 g 275 t ORIGIN 1 atgaagaagg agcatgtgct tcactgccag ttctccgcgt ggtacccgtt cttccgaggc 61 gttaccatca agagtgtcat tcttccactt cctcagaatg tgaaggatta tttactcgat 121 gatggaactc tggtggtttc aggaagggat gatccaccaa cacattctca gccagacagt 181 gatgatgaag cagaagaaat acagtggtct gatgatgaga acacagccac gcttacggca 241 ccagaatttc ctgagtttgc cactaaagtc caggaagcta tcaattccct cgggggcagt 301 gtctttccta agcttaattg gagtgcccca agggatgcgt attggatagc aatgaatagt 361 tctctgaaat gtaaaaccct cagcgacatc tttctgcttt tcaagagttc cgatttcatc 421 actcgtgact tcactcagcc gtttattcat tgtactgatg attctccaga tccatgtata 481 gaatatgagc tcgttctccg aaaatggtgt gaattgattc ctggggctga gtttcgatgt 541 tttgtcaagg aaaacaagct tattggtatt tctcaaagag actacacaca atactatgat 601 catatttcta aacaaaagga agaaattcgc agatgcatac aagacttttt caagaaacac 661 atacagtaca aattcttaga tgaagacttt gtgttcgata tatacagaga cagtaggggg 721 aaggtgtggc tcattgactt taatccattt ggtgaagtca cagattcact gctgttcacc 781 tgggaagaac tgatatctga gaacaactta aacggcgatt ttagtgaagt tgacgctcaa 841 gagcaggatt ccccagcttt ccgttgcaca aacagtgaag tgacagtcca gcccagcccc 901 tatttgagtt accggctacc caaggacttt gtagacctct ctactgggga ggacgctcac 961 aagctaatag acttccttaa gctgaagaga aatcagcagg aggacgatta a //