LOCUS       CR456966                1011 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834B085D for
            gene C10orf7, chromosome 10 open reading frame 7; complete cds,
            incl. stopcodon.
ACCESSION   CR456966
VERSION     CR456966.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1011)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 1011)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834B085D, ORFNo 1450
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834B085D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence BC001600 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..1011
                     /db_xref="H-InvDB:HIT000267816"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834B085D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..1011
                     /codon_start=1
                     /gene="C10orf7"
                     /db_xref="GOA:O75794"
                     /db_xref="H-InvDB:HIT000267816.12"
                     /db_xref="HGNC:HGNC:16827"
                     /db_xref="InterPro:IPR009772"
                     /db_xref="UniProtKB/Swiss-Prot:O75794"
                     /protein_id="CAG33247.1"
                     /translation="MKKEHVLHCQFSAWYPFFRGVTIKSVILPLPQNVKDYLLDDGTL
                     VVSGRDDPPTHSQPDSDDEAEEIQWSDDENTATLTAPEFPEFATKVQEAINSLGGSVF
                     PKLNWSAPRDAYWIAMNSSLKCKTLSDIFLLFKSSDFITRDFTQPFIHCTDDSPDPCI
                     EYELVLRKWCELIPGAEFRCFVKENKLIGISQRDYTQYYDHISKQKEEIRRCIQDFFK
                     KHIQYKFLDEDFVFDIYRDSRGKVWLIDFNPFGEVTDSLLFTWEELISENNLNGDFSE
                     VDAQEQDSPAFRCTNSEVTVQPSPYLSYRLPKDFVDLSTGEDAHKLIDFLKLKRNQQE
                     DD"
BASE COUNT          294 a          216 c          226 g          275 t
ORIGIN      
        1 atgaagaagg agcatgtgct tcactgccag ttctccgcgt ggtacccgtt cttccgaggc
       61 gttaccatca agagtgtcat tcttccactt cctcagaatg tgaaggatta tttactcgat
      121 gatggaactc tggtggtttc aggaagggat gatccaccaa cacattctca gccagacagt
      181 gatgatgaag cagaagaaat acagtggtct gatgatgaga acacagccac gcttacggca
      241 ccagaatttc ctgagtttgc cactaaagtc caggaagcta tcaattccct cgggggcagt
      301 gtctttccta agcttaattg gagtgcccca agggatgcgt attggatagc aatgaatagt
      361 tctctgaaat gtaaaaccct cagcgacatc tttctgcttt tcaagagttc cgatttcatc
      421 actcgtgact tcactcagcc gtttattcat tgtactgatg attctccaga tccatgtata
      481 gaatatgagc tcgttctccg aaaatggtgt gaattgattc ctggggctga gtttcgatgt
      541 tttgtcaagg aaaacaagct tattggtatt tctcaaagag actacacaca atactatgat
      601 catatttcta aacaaaagga agaaattcgc agatgcatac aagacttttt caagaaacac
      661 atacagtaca aattcttaga tgaagacttt gtgttcgata tatacagaga cagtaggggg
      721 aaggtgtggc tcattgactt taatccattt ggtgaagtca cagattcact gctgttcacc
      781 tgggaagaac tgatatctga gaacaactta aacggcgatt ttagtgaagt tgacgctcaa
      841 gagcaggatt ccccagcttt ccgttgcaca aacagtgaag tgacagtcca gcccagcccc
      901 tatttgagtt accggctacc caaggacttt gtagacctct ctactgggga ggacgctcac
      961 aagctaatag acttccttaa gctgaagaga aatcagcagg aggacgatta a
//