LOCUS CR456964 852 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834B065D for gene VDAC2, voltage-dependent anion channel 2; complete cds, incl. stopcodon. ACCESSION CR456964 VERSION CR456964.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 852) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 852) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834B065D, ORFNo 1447 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834B065D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence BC012883 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..852 /db_xref="H-InvDB:HIT000267814" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834B065D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..852 /codon_start=1 /gene="VDAC2" /db_xref="GOA:P45880" /db_xref="H-InvDB:HIT000267814.12" /db_xref="HGNC:HGNC:12672" /db_xref="InterPro:IPR001925" /db_xref="InterPro:IPR023614" /db_xref="InterPro:IPR027246" /db_xref="InterPro:IPR030277" /db_xref="UniProtKB/Swiss-Prot:P45880" /protein_id="CAG33245.1" /translation="MCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTS GSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTT FSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSA KSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTR FGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVG LALELEA" BASE COUNT 242 a 164 c 209 g 237 t ORIGIN 1 atgtgtattc ctccatcata tgctgacctt ggcaaagctg ccagagatat tttcaacaaa 61 ggatttggtt ttgggttggt gaaactggat gtgaaaacaa agtcttgcag tggcgtggaa 121 ttttcaacgt ccggttcatc taatacagac actggtaaag ttactgggac cttggagacc 181 aaatacaagt ggtgtgagta tggtctgact ttcacagaaa agtggaacac tgataacact 241 ctgggaacag aaatcgcaat tgaagaccag atttgtcaag gtttgaaact gacatttgat 301 actaccttct caccaaacac aggaaagaaa agtggtaaaa tcaagtcttc ttacaagagg 361 gagtgtataa accttggttg tgatgttgac tttgattttg ctggacctgc aatccatggt 421 tcagctgtct ttggttatga gggctggctt gctggctacc agatgacctt tgacagtgcc 481 aaatcaaagc tgacaaggaa taactttgca gtgggctaca ggactgggga cttccagcta 541 cacactaatg tcaatgatgg gacagaattt ggaggatcaa tttatcagaa agtttgtgaa 601 gatcttgaca cttcagtaaa ccttgcttgg acatcaggta ccaactgcac tcgttttggc 661 attgcagcta aatatcagtt ggatcccact gcttccattt ctgcaaaagt caacaactct 721 agcttaattg gagtaggcta tactcagact ctgaggcctg gtgtgaagct tacactctct 781 gctctggtag atgggaagag cattaatgct ggaggccaca aggttgggct cgccctggag 841 ttggaggctt aa //