LOCUS       CR456964                 852 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834B065D for
            gene VDAC2, voltage-dependent anion channel 2; complete cds, incl.
            stopcodon.
ACCESSION   CR456964
VERSION     CR456964.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 852)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 852)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834B065D, ORFNo 1447
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834B065D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence BC012883 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..852
                     /db_xref="H-InvDB:HIT000267814"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834B065D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..852
                     /codon_start=1
                     /gene="VDAC2"
                     /db_xref="GOA:P45880"
                     /db_xref="H-InvDB:HIT000267814.12"
                     /db_xref="HGNC:HGNC:12672"
                     /db_xref="InterPro:IPR001925"
                     /db_xref="InterPro:IPR023614"
                     /db_xref="InterPro:IPR027246"
                     /db_xref="InterPro:IPR030277"
                     /db_xref="UniProtKB/Swiss-Prot:P45880"
                     /protein_id="CAG33245.1"
                     /translation="MCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTS
                     GSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTT
                     FSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSA
                     KSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTR
                     FGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVG
                     LALELEA"
BASE COUNT          242 a          164 c          209 g          237 t
ORIGIN      
        1 atgtgtattc ctccatcata tgctgacctt ggcaaagctg ccagagatat tttcaacaaa
       61 ggatttggtt ttgggttggt gaaactggat gtgaaaacaa agtcttgcag tggcgtggaa
      121 ttttcaacgt ccggttcatc taatacagac actggtaaag ttactgggac cttggagacc
      181 aaatacaagt ggtgtgagta tggtctgact ttcacagaaa agtggaacac tgataacact
      241 ctgggaacag aaatcgcaat tgaagaccag atttgtcaag gtttgaaact gacatttgat
      301 actaccttct caccaaacac aggaaagaaa agtggtaaaa tcaagtcttc ttacaagagg
      361 gagtgtataa accttggttg tgatgttgac tttgattttg ctggacctgc aatccatggt
      421 tcagctgtct ttggttatga gggctggctt gctggctacc agatgacctt tgacagtgcc
      481 aaatcaaagc tgacaaggaa taactttgca gtgggctaca ggactgggga cttccagcta
      541 cacactaatg tcaatgatgg gacagaattt ggaggatcaa tttatcagaa agtttgtgaa
      601 gatcttgaca cttcagtaaa ccttgcttgg acatcaggta ccaactgcac tcgttttggc
      661 attgcagcta aatatcagtt ggatcccact gcttccattt ctgcaaaagt caacaactct
      721 agcttaattg gagtaggcta tactcagact ctgaggcctg gtgtgaagct tacactctct
      781 gctctggtag atgggaagag cattaatgct ggaggccaca aggttgggct cgccctggag
      841 ttggaggctt aa
//