LOCUS CR456962 501 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834B025D for gene MYL2, myosin, light polypeptide 2, regulatory, cardiac, slow; complete cds, incl. stopcodon. ACCESSION CR456962 VERSION CR456962.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 501) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 501) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834B025D, ORFNo 1436 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834B025D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence BC031006 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..501 /db_xref="H-InvDB:HIT000267812" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834B025D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..501 /codon_start=1 /gene="MYL2" /db_xref="GOA:Q6IB42" /db_xref="H-InvDB:HIT000267812.12" /db_xref="InterPro:IPR002048" /db_xref="InterPro:IPR011992" /db_xref="InterPro:IPR018247" /db_xref="UniProtKB/TrEMBL:Q6IB42" /protein_id="CAG33243.1" /translation="MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFI DKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNA FKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIIT HGEEKD" BASE COUNT 149 a 114 c 137 g 101 t ORIGIN 1 atggcaccta agaaagcaaa gaagagagcc gggggcgcca actccaacgt gttctccatg 61 ttcgaacaga cccaaatcca ggaatttaag gaggccttca ctatcatgga ccagaacagg 121 gatggcttca ttgacaagaa cgatctgaga gacacctttg ctgcccttgg gcgagtgaac 181 gtgaaaaatg aagaaattga tgaaatgatc aaggaggctc cgggtccaat taactttact 241 gtgttcctca caatgtttgg ggagaaactt aagggagcgg accctgagga aaccattctc 301 aacgcattca aagtgtttga ccctgaaggc aaaggggtgc tgaaggctga ttacgttcgg 361 gaaatgctga ccacgcaggc ggagaggttt tccaaggagg aggttgacca gatgttcgcc 421 gccttccccc ctgacgtgac tggcaacttg gactacaaga acctggtgca catcatcacc 481 cacggagaag agaaggatta a //